KEGG   Oryctolagus cuniculus (rabbit): 100345408
Entry
100345408         CDS       T03373                                 
Name
(RefSeq) NEDD8-conjugating enzyme UBE2F-like
  KO
K10687  ubiquitin-conjugating enzyme E2 F [EC:2.3.2.34]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100345408
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100345408
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.34  E2 NEDD8-conjugating enzyme
     100345408
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100345408
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 100345408
NCBI-ProteinID: XP_017196871
Ensembl: ENSOCUG00000000018
LinkDB
Position
3:complement(83213892..83214778)
AA seq 228 aa
MLTLASKLKRDDGLRGSRTAASAADSTQRVSVRDKLLVKEVAELEANLPCTCKVHFPDPN
KLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPRVRCLTRMWHPNITETGEICLSLL
REHSIDSTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDXRRTSGIKWTTT
SSATPDDEGPRATAVQFDSDVKPPAAPPPSSHSLSGPLDCPRPVAMWS
NT seq 687 nt   +upstreamnt  +downstreamnt
atgctgacgctggccagcaagctgaagcgggacgatgggctcagagggtcccggacggca
gcctcggcagcggactccacgcagagggtctccgtgagagacaagctgctcgtgaaagag
gttgcagaacttgaagctaatttaccttgtacttgtaaagtgcatttccctgacccaaac
aagctgcactgcttccagctcactgtcaccccagatgagggttactaccagggtggaaaa
tttcagtttgaaactgaagttcctgatgcatacaacatggtgcctccccgagtgagatgc
ttgactaggatgtggcaccctaacatcacagagacaggggagatctgtctaagtttactg
agagaacattcgattgacagcacgggctgggctcccacgaggacattaaaggatgttgtt
tggggattaaactctttatttactgatcttctgaactttgacgatccactgaatatcgaa
gcagcagagcatcatttgcgggacnnaagaaggacttctggaataaagtggacgactaca
tcaagcgctacgccagatgatgaagggccgcgtgctacagccgtgcagtttgattctgac
gtaaagccgccagccgcccctcccccgtcctcacactccctctcaggccccctggattgc
ccccgtcctgtggctatgtggtcctga

KEGG   Oryctolagus cuniculus (rabbit): 100348202
Entry
100348202         CDS       T03373                                 
Symbol
UBE2F
Name
(RefSeq) ubiquitin conjugating enzyme E2 F (putative)
  KO
K10687  ubiquitin-conjugating enzyme E2 F [EC:2.3.2.34]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100348202 (UBE2F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100348202 (UBE2F)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.34  E2 NEDD8-conjugating enzyme
     100348202 (UBE2F)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100348202 (UBE2F)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 100348202
NCBI-ProteinID: XP_008250220
LinkDB
Position
Un
AA seq 173 aa
MLTLASKLKRDDGLRGSRTAASAADSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPN
KLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPRVRCLTRMWHPNITETGEICLSLL
REHSIDGTGWAPTRTLKDVVWGLNSLFTVSILTRLPGVLCVLAAGLSITLSGV
NT seq 522 nt   +upstreamnt  +downstreamnt
atgctgacgctggccagcaagctgaagcgggacgacgggctcagagggtcccggacggca
gcctcggcggcggactccacgcggagggtctccgtgagagacaagctgctcgtgaaagag
gttgcagaacttgaagctaatttaccttgtacctgtaaagtgcatttccctgacccaaac
aagctgcactgcttccagctcactgtcaccccagatgagggttactaccagggtggaaaa
tttcagtttgaaactgaagttcctgatgcatacaacatggtgcctccccgagtgagatgc
ttgactaggatgtggcaccctaacatcacagagacaggggagatctgtctaagtttactg
agagaacattcgattgacggcacgggctgggctcccacaaggacattaaaggatgttgtc
tggggattaaactctttatttactgtaagtatactgaccagactcccaggtgtcctttgc
gtcttggctgcaggtttaagcatcaccttaagcggagtttga

DBGET integrated database retrieval system