KEGG   Oryctolagus cuniculus (rabbit): 100345500
Entry
100345500         CDS       T03373                                 
Symbol
CCR8
Name
(RefSeq) C-C motif chemokine receptor 8
  KO
K04183  C-C chemokine receptor type 8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100345500 (CCR8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100345500 (CCR8)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100345500 (CCR8)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100345500 (CCR8)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100345500 (CCR8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100345500 (CCR8)
   04050 Cytokine receptors [BR:ocu04050]
    100345500 (CCR8)
   04090 CD molecules [BR:ocu04090]
    100345500 (CCR8)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    100345500 (CCR8)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CC Chemokine
   100345500 (CCR8)
CD molecules [BR:ocu04090]
 Proteins
  100345500 (CCR8)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF2393
Other DBs
NCBI-GeneID: 100345500
NCBI-ProteinID: XP_017199776
Ensembl: ENSOCUG00000011958
UniProt: G1T2B2
LinkDB
Position
9:complement(4357519..4359022)
AA seq 355 aa
MDYTLEPNVTAVTDYYYPDIFSSPCDGELTQRRSKLPLAIFYCLLFVSGLLGNGLVILVL
VAYKKLQSITDIYLLNLALSDLLFVFSFPFLTHYQLDQWVFGTPMCKLVSGLYYVGFFSN
MFFITLMSVDRYLAVVHAVCALRVRTARTGVALSLAVWLTAIMATSPLLVFYQVVPEDGV
LQCYLSYNQQTLRWKIFTHLEMNVLGLLIPFAVLMFCYVRILQQLRHCQNHNKTKAIKLV
LIVVLASLLFWVPFNVVLFLTSLHNMHVLDGCVINQRLIYATHVTEAISFTHCCVNPVIY
AFMGEKFKKYLSDIFQKSCSHVVFYIGRNVSRQGYERSSSFPPSSSRSSIMDHIL
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggattacaccctcgagcccaacgtgacagcagtgactgactactattaccctgatatc
ttctcgagcccctgtgatggagaacttacccagagacgcagcaagttgccgcttgccatc
ttctactgcctcctgttcgtgtcaggcctgctgggaaacggtctggtcatcctggtgctt
gtggcctacaagaagctgcagagcatcacggacatctacctcttgaacttggccctgtcg
gacctgctcttcgtcttctccttcccctttctgacccactatcagctggaccagtgggtg
tttgggactccgatgtgcaagctggtgtctggcctctattacgtcggcttcttcagcaac
atgttcttcatcaccctcatgagcgtggacaggtacctggctgtcgtccatgctgtgtgt
gccctcagagtgaggacggccaggacgggcgtggctctgagcctggccgtgtggctgacc
gccatcatggccaccagcccgttgctggtgttttatcaggtggtccctgaagacggcgtt
ctgcagtgttacttgtcctacaaccagcagactctgaggtggaagatcttcacccacttg
gaaatgaacgtcttgggcctgttgatccccttcgccgtcctcatgttctgctacgtccgc
atcctgcagcagctgagacattgccaaaaccacaacaagaccaaggccatcaagctggtg
ctcattgtggtccttgcgtccttgctcttctgggtccccttcaacgtggtcctcttcctc
acctccctgcacaacatgcacgtcttggacggctgtgtcataaaccagcggctgatttac
gccacccacgtcacggaggccatttccttcacgcactgctgtgtgaaccctgtcatctat
gccttcatgggagagaagttcaagaaatacctctctgacatatttcagaagagctgcagc
cacgttgtcttctacataggcaggaacgtgtcccggcagggctacgagaggtcatcttcc
ttccccccgtcttcctcgcgttcctccatcatggaccacatcttgtga

DBGET integrated database retrieval system