KEGG   Oryctolagus cuniculus (rabbit): 100345665
Entry
100345665         CDS       T03373                                 
Symbol
CDC23
Name
(RefSeq) cell division cycle 23
  KO
K03355  anaphase-promoting complex subunit 8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100345665 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100345665 (CDC23)
   04114 Oocyte meiosis
    100345665 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100345665 (CDC23)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100345665 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100345665 (CDC23)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100345665 (CDC23)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100345665 (CDC23)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100345665 (CDC23)
SSDB
Motif
Pfam: TPR_1 ANAPC8 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 TPR_16 TPR_17 ANAPC3 TPR_12 DUF772 TPR_9 TPR_15 TPR-S
Other DBs
NCBI-GeneID: 100345665
NCBI-ProteinID: XP_002710281
Ensembl: ENSOCUG00000008382
UniProt: G1SV17
LinkDB
Position
3:complement(20485817..20513760)
AA seq 597 aa
MAASTSVVPVAVTAAVAPVLATNADFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLAELQPPPPVTEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPTSEMPAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggctgcgagtacgtctgtagtcccggtggctgtgacggcggctgtggcgcctgttctg
gccacgaacgccgatttctcagatttgcgggaaattaaaaagcagctgctgcttatcgca
ggccttacccgggagcggggcctgctgcacagtagcaaatggtcggcggagttggccttc
tccctcccggccctgcctttggccgagctgcagccgccgccgcctgttaccgaggaggat
gcccaggacatggatgcttacaccctggccaaggcctactttgatgttaaagagtatgat
cgggcagcacatttcctgcacggctgcaatagcaagaaagcctatttcctgtacatgtat
tccagatatctgtctggagagaaaaagaaggatgatgaaacagttgatagcctaggcccc
ttggaaaaaggacaagtgaaaaatgaggctcttagagaactgagagtggagcttagcaaa
aaacaccaagctcgggaacttgatggatttggcctttatctatatggtgtggtgcttcga
aaactggacttggtgaaagaggccattgatgtgtttgtggaggccacccatgttttacct
ttgcattggggagcctggttagaactttgtaacctgatcacagacaaagagatgctgaag
ttcctgtctttgccagacacctggatgaaagagttttttctggctcatatatacacagag
ttgcagttgatagaggaggcccttcagaagtatcagaatctcattgatgtgggcttttct
aaaagctcttatattgtttcccaaattgcagttgcctatcacaatatcagagatatcgac
aaagccctgtccatttttaatgagctaaggaagcaagacccttacaggattgaaaatatg
gacacattctccaacctgctttatgtcagaagtatgaaatctgaattgagttatttggct
cataacctctgtgagattgataaatatcgtgtagaaacatgctgtgtaattggtaattat
tatagtttacgttctcagcatgagaaagcagccttatatttccagagagccctgaaattg
aatcctcggtacctaggggcctggacactgatgggacatgagtacatggaaatgaagaac
acctctgctgctatccaggcttacagacatgccattgaagtcaacaagcgggactacaga
gcctggtatggcctagggcagacctatgaaatccttaaaatgccattttactgcctttat
tattacagacgggcccaccagcttcggcccaatgattctcgtatgctggttgctttagga
gaatgttatgagaaactcaatcaactagtagaagccaaaaagtgttactggagagcttat
gctgtgggagatgtggagaagatggctctggtgaaactggcaaagcttcacgaacaattg
accgaatcagaacaggctgcccagtgctacatcaaatatattcaagatatctattcctgt
ggggaaatagtggaacacttggaggaaagcacagccttccgctatctggcccagtactat
tttaagtgcaagctgtgggatgaagcttcaacttgcgcccagaagtgttgtgcattcaat
gatacccgggaagaaggtaaggccttgcttcggcaaatcctacagctccggaaccaaggt
gaaactccgaccagtgagatgcctgctccctttttcctccctgcctcgctgtctgccaac
aacactcccacccgcagagtttctccactcaacttgtcttctgtcacaccataa

DBGET integrated database retrieval system