Oryctolagus cuniculus (rabbit): 100345683 Help Entry 100345683         CDS       T03373                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04613   Neutrophil extracellular trap formation ocu05034   Alcoholism ocu05202   Transcriptional misregulation in cancer ocu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ocu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100345683  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100345683   09163 Immune disease    05322 Systemic lupus erythematosus     100345683   09165 Substance dependence    05034 Alcoholism     100345683  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ocu03036]     100345683   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100345683 Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100345683 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100345683 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  100345683 NCBI-ProteinID:  XP_017200429 UniProt:  G1TWR1 LinkDB All DBs Position 12:144863404..144863898 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacagcgcgcaagtcgacgggcggcaaggcgccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtcaagaagccgcac cgctaccggcccggcacggtggcgctgcgcgagatccggcgctaccagaagtccaccgag ctgctcatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag acggacctgcgcttccagagctcggccgtcatggcgctgcaggaggcctgcgaggcctac ctcgtcggcctcttcgaggacaccaacctctgcgccatccacgccaagcgcgtcaccatc atgcccaaagacatccagctggcgcgccgcatccgcggggagcgggcctaa

DBGET integrated database retrieval system