KEGG   Oryctolagus cuniculus (rabbit): 100345752
Entry
100345752         CDS       T03373                                 
Symbol
CUL1
Name
(RefSeq) cullin 1
  KO
K03347  cullin 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04141  Protein processing in endoplasmic reticulum
ocu04310  Wnt signaling pathway
ocu04340  Hedgehog signaling pathway
ocu04350  TGF-beta signaling pathway
ocu04710  Circadian rhythm
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100345752 (CUL1)
   04120 Ubiquitin mediated proteolysis
    100345752 (CUL1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100345752 (CUL1)
   04340 Hedgehog signaling pathway
    100345752 (CUL1)
   04350 TGF-beta signaling pathway
    100345752 (CUL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100345752 (CUL1)
   04114 Oocyte meiosis
    100345752 (CUL1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100345752 (CUL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100345752 (CUL1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100345752 (CUL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100345752 (CUL1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     100345752 (CUL1)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 DUF4980
Other DBs
NCBI-GeneID: 100345752
NCBI-ProteinID: XP_017198157
Ensembl: ENSOCUG00000002543
LinkDB
Position
7:complement(3207890..3272302)
AA seq 776 aa
MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGGPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKMKDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDE
VELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgtcatccaacaggagtcagaatccccatggactgaagcagattggccttgaccagatc
tgggacgacctcagagctggaatccagcaagtgtataccagacaaagtatggctaagtcc
agatacatggaactctatactcatgtttataactactgcacgagcgtgcaccagtccaac
caagcccggggggctggtggcccgccttccaagtcaaaaaaggggcagacacctggagga
gctcagtttgttggcttggaattatacaaacgacttaaggaatttttgaagaattacttg
acaaatcttcttaaggatggagaagatttgatggatgagagtgtactgaaattctacact
caacaatgggaagattatcgattttcaagcaaagtgttgaatggaatttgtgcctacctc
aatagacattgggttcgccgtgaatgtgacgaaggacgaaaaggaatatatgaaatctat
tcacttgcattggtgacttggagagattgtctgttcaggccattgaataaacaggtaaca
aatgctgtcttaaaactgattgaaaaggaaagaaatggtgaaaccatcaatacaagactg
attagtggagttgtacagtcttatgtggaattggggctgaatgaagatgatgcatttgca
aagggtcctacgttaacagtgtataaagaatcctttgaatctcaatttttggctgacaca
gaaagattttataccagagagagtactgaattcttgcaacagaacccagttaccgaatat
atgaaaaaggcagaggcgcgcctgctcgaggagcagcggagagtccaggtctaccttcac
gaaagcacccaggacgagctggcgcgcaagtgtgagcaggtcctcatcgagaagcacttg
gaaatcttccacacggagtttcagaatttgctggatgctgacaaaatgaaggatctgggg
cgcatgtataaccttgtctccaggatccaggatggcctaggagaactgaaaaaactgctg
gagacacacatccacaatcagggtcttgcagcaattgagaagtgtggagaagctgctttg
aacgaccccaaaatgtatgtacagacagtgctagatgttcataaaaagtacaacgccctg
gtgatgtcagcattcaacaacgacgctggcttcgtggctgcgcttgacaaggcttgtggc
cgcttcataaacaacaatgcagtaaccaaaatggctcagtcatccagtaaatcccctgag
ctgctggctcgatactgtgactccttgttgaagaaaagttccaagaacccagaagaggct
gagctagaagacacgcttaatcaagtgatggttgtcttcaagtacatcgaggacaaagat
gtgtttcagaagttctacgcgaagatgctggccaagcgactggtgcatcagaacagtgca
agtgacgacgctgaagcaagcatgatctccaagttaaagcaagcttgtggctttgagtac
acctctaagctccagcggatgtttcaggacatcggtgtcagcaaggatctgaacgagcag
ttcaagaaacacctgacgaattcggagccactagacctggacttcagcatccaggtgctg
agctcggggtcctggcccttccagcagtcctgcacgttcgccttgccctcggagctggag
cggagctaccagcgcttcacggccttctacgccagccggcacagcggccggaagctgacg
tggctgtatcagctgtctaaaggagaactggtcaccaactgcttcaagaacaggtacacc
ttgcaggcatccacgttccagatggcgatcctgctgcagtacaacacggaagacgcctac
acggtccaacagctgactgacagcactcagattaaaatggacattttggcccaagtcctc
cagattttattgaagtcaaagttactggtcttggaagatgaaaatgcgaacgtcgatgaa
gtggaattgaagccggacaccttaataaaattgtatcttggctataaaaacaagaagtta
agggtgaacatcaacgtgcccatgaagacggagcagaagcaggagcaggagaccacgcac
aagaacattgaggaggaccgcaaactgctgatccaggcggccattgtgcgaatcatgaag
atgaggaaggtgctgaagcaccagcagctgctcggcgaggtcctcactcagctgtcgtcc
aggttcaagccgcgggtcccggtgatcaagaaatgcattgacattctgattgagaaggag
tatttggagcgcgtggacggcgagaaggacacctacagttacctggcctag

DBGET integrated database retrieval system