KEGG   Oryctolagus cuniculus (rabbit): 100345869
Entry
100345869         CDS       T03373                                 
Symbol
IL25
Name
(RefSeq) interleukin 25
  KO
K05493  interleukin 17E
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100345869 (IL25)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100345869 (IL25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100345869 (IL25)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100345869 (IL25)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 100345869
NCBI-ProteinID: XP_002717952
Ensembl: ENSOCUG00000011028
LinkDB
Position
17:43569097..43572136
AA seq 168 aa
MHQVVAFLAMVVGTHTLCLELWKDCSHRSTCCTSKGQALPEEWLQWTPVPVTPPELELTH
PQESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPLGN
SELLYHNQTVFYRRPCRGERGLRQGYCLERRLYRVSLACVCVRPRVMA
NT seq 507 nt   +upstreamnt  +downstreamnt
atgcaccaggtggtggcgttcctggcaatggtcgtggggacccacaccctctgtttggag
ctttggaaggactgcagtcacaggtctacctgctgcaccagtaaagggcaggccctccct
gaggagtggctgcagtggactcctgtgcccgtgactcccccagagctggagctcacccac
ccccaagaatcctgcagggccagcgaagacggacccctcaatagcagggccatctccccc
tggagatacgagttggaccgggacctgaaccggctcccccaggacctgtaccacgcccgc
tgcctgtgcccgcactgcgtcagtctccagacgggctcccacatggaccccctgggcaat
tcggagctgctctaccacaaccagaccgtcttctaccggaggccgtgccgcggcgagcgc
gggctccgccagggatactgcctggagcgccggctctaccgcgtctccttggcttgcgtg
tgcgtgaggccccgggtgatggcttag

DBGET integrated database retrieval system