Oryctolagus cuniculus (rabbit): 100345872 Help Entry 100345872         CDS       T03373                                  Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04014   Ras signaling pathway ocu04072   Phospholipase D signaling pathway ocu04144   Endocytosis ocu04666   Fc gamma R-mediated phagocytosis ocu05132   Salmonella infection ocu05135   Yersinia infection Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100345872    04072 Phospholipase D signaling pathway     100345872  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100345872  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     100345872  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     100345872  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100345872   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100345872    04031 GTP-binding proteins [BR:ocu04031]     100345872 Membrane trafficking [BR:ocu04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     100345872   Arf GTPases and associated proteins    Arf GTPases     100345872 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100345872   Exosomal proteins of colorectal cancer cells    100345872 GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     100345872 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  100345872 NCBI-ProteinID:  XP_051678776 Ensembl:  ENSOCUG00000001692 LinkDB All DBs Position 17:69849602..69852875 Genome browser AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaggtgctatccaaaatcttcgggaacaaggaaatgcggatcctcatgttgggc ctggacgcggccggcaagaccacaatcctgtacaagttgaagctgggccagtcggtgacc accatccccaccgtgggcttcaacgtggagacggtgacttacaaaaacgtcaagttcaac gtgtgggatgtgggaggccaggacaagatccggccgctctggcggcactactacaccggg acccagggtctgatcttcgtggtggactgcgccgaccgcgaccgcatcgacgaggcccgc caggagctgcaccgcattatcaatgaccgggagatgagggacgccataatcctcatcttc gccaacaagcaggacctgcccgatgccatgaaaccccatgagatccaggagaaactgggc ctgacccggattcgggacaggaactggtatgtgcagccctcctgtgccacctcaggggac ggactctatgaggggctcacatggttaacctctaactacaagtcctaa

DBGET integrated database retrieval system