KEGG   Oryctolagus cuniculus (rabbit): 100345904
Entry
100345904         CDS       T03373                                 
Symbol
CHMP7
Name
(RefSeq) charged multivesicular body protein 7
  KO
K15053  charged multivesicular body protein 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100345904 (CHMP7)
  09143 Cell growth and death
   04217 Necroptosis
    100345904 (CHMP7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100345904 (CHMP7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100345904 (CHMP7)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    100345904 (CHMP7)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100345904 (CHMP7)
SSDB
Motif
Pfam: Snf7 PspA_IM30 Fez1 LPP FLYWCH_u FapA
Other DBs
NCBI-GeneID: 100345904
NCBI-ProteinID: XP_002723426
Ensembl: ENSOCUG00000015668
LinkDB
Position
Un
AA seq 450 aa
MWSPEREAEAPAGGDPAGLLPPEWEEDEERMSFLFSAFKRSREVNSTDWDSKMGFWAPLV
LSHSRRQGVVRLRLRDLQEAFQRKGSVPLGLATVLQDLLRRGELQRESDFMASVDSSWIS
WGVGVFLLKPLKWTLSNVLGDSKVPAEEVLVAVELLKEKAEEVYRLYQNSPLSSHPVVAL
AELSTLCANSCPDERTFYLVLLQLQKEKRVTVLEQNGEKIVKFARGPHAKVSPVNDVDVG
VYQLMQSEQLLSRKVESLSQEAERCKEEARRACRAGKKQLALRSLKARQRTEKRIEALHA
KLDTVQGILDRIYASQTDQMVFHAYQAGVGALKLSMKDVTVEKAESLVDQIQELCDTQDE
VSQTLAGGVTNGIDFDSEELEKELDILLQDTTKDPLELPDSAPKPLPANSVPHPRISDAE
LEAELEKLSLSEGGLVPSSKSPKRQLEPTL
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgtggtccccggagcgggaggccgaggcgccggccgggggagacccggcgggcctgctg
ccccccgagtgggaggaggatgaggagcgcatgtccttcctgttttccgcgttcaagagg
agtcgcgaggtgaacagcaccgactgggacagcaagatgggcttctgggcgccgttggtg
ctgagccacagccgccgccagggggtggtgcgcctgcgtctgcgggacttgcaggaggcc
tttcagcgcaagggcagcgtcccgctggggctggccacggtgctgcaggacctgctgcgc
cgaggggagctgcagcgggagtcagacttcatggccagtgtggacagcagctggatctcc
tggggggtcggagtcttcctgctgaagcccctcaagtggaccctctctaacgtgctgggg
gatagcaaggtcccggccgaggaggtgctggtggccgtggagctgctaaaggaaaaggcc
gaggaggtgtaccgcctgtaccagaactccccgctctcctcgcaccccgtggtggcgcta
gcggagctgagcaccctgtgcgcgaactcctgcccggacgagcggaccttctacttggtg
ttgctgcagctgcagaaggagaagcgagtcaccgtgctggagcagaacggggagaagatt
gtcaagttcgcccggggcccacacgccaaggtctcgcccgtgaacgacgtggacgtcggg
gtgtaccagttgatgcagagcgagcagcttctctcgcgcaaggtggagtccttatcccag
gaagcagagaggtgtaaagaagaagcccgccgggcgtgccgagcaggaaagaagcagctg
gcgctgaggtctctgaaggccaggcagcggacggagaagcgcatcgaggccttgcacgcc
aagctggacaccgtgcagggcatcctggaccgcatctacgcctcccagacagatcagatg
gtgttccacgcctaccaggctggggtgggcgccctgaaactctccatgaaggacgtcacc
gtggagaaggcggagagcctcgtcgaccagatccaggagctgtgtgacacccaggatgaa
gtttcgcagactctggctggtggggtgaccaatggcatagatttcgacagtgaggagctg
gagaaggagttggacatcctccttcaggacaccaccaaagaccctctggagctgcccgac
agcgcccccaagccgcttcccgccaacagtgtgcctcaccctcggatctcggacgccgaa
cttgaagccgaactggagaaactgtccttgtcagagggaggtttggtcccaagcagtaaa
tctccaaaaaggcaattggaaccgactctctaa

DBGET integrated database retrieval system