KEGG   Oryctolagus cuniculus (rabbit): 100345952
Entry
100345952         CDS       T03373                                 
Symbol
CAPZB
Name
(RefSeq) capping actin protein of muscle Z-line beta subunit
  KO
K10365  capping protein (actin filament) muscle Z-line, beta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100345952 (CAPZB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100345952 (CAPZB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100345952 (CAPZB)
   04147 Exosome [BR:ocu04147]
    100345952 (CAPZB)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Others
   WASH complex
    100345952 (CAPZB)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     100345952 (CAPZB)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100345952 (CAPZB)
SSDB
Motif
Pfam: F_actin_cap_B
Other DBs
NCBI-GeneID: 100345952
NCBI-ProteinID: XP_017202004
Ensembl: ENSOCUG00000014711
UniProt: G1T7Y7
LinkDB
Position
13:133457877..133577485
AA seq 301 aa
MHPSRRSLPFPLNCQLVRVGTADYGGLSDQSDQQLDCALDLMRRLPPQQIEKNLSDLIDL
VPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSA
RLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSI
HVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIA
NIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQ
S
NT seq 906 nt   +upstreamnt  +downstreamnt
atgcatcccagcaggcgcagcctcccgttccccctgaactgtcagctggtgagggttgga
actgcggactatggaggcttgtcggatcagagtgaccagcagctggactgtgccttggac
ctaatgaggcgcctgcctccgcagcagatcgagaagaacctcagcgacctgatcgacctg
gtccccagtctgtgtgaagacctcctgtcttctgtggatcagcccctgaagatcgccagg
gacaaggtggtgggcaaggattacctgctgtgtgactacaacagagacggagactcgtat
aggtcaccatggagcaacaagtacgaccctccattggaagatggggccatgccgtccgcg
cggctcaggaagctggaggtggaagccaacaatgcctttgaccagtaccgagacctgtat
tttgaaggtggtgtctcatctgtctacctctgggatctggatcatggctttgcgggagtg
atcctcataaagaaggctggagatggatcaaagaagatcaaaggctgctgggattccatc
cacgtggtggaagtgcaggagaagtccagtggccgcaccgcccactacaagctgacttcc
acggtgatgctgtggctgcagaccaacaaatccggctcgggtaccatgaacctcggaggc
agccttaccagacagatggagaaagatgagactgtgagtgactgctccccacacatagcc
aacatcgggcgcctggtagaggacatggaaaataaaatccgaagtacgctgaatgagatc
tactttgggaaaacgaaggacatcgtcaacgggctgaggtctgtgcagacttttgcagac
aaatctaaacaagaagcgcttaagaacgacctggtggaggctttgaagagaaagcagcag
agctaa

KEGG   Oryctolagus cuniculus (rabbit): 103348163
Entry
103348163         CDS       T03373                                 
Name
(RefSeq) F-actin-capping protein subunit beta-like
  KO
K10365  capping protein (actin filament) muscle Z-line, beta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103348163
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    103348163
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    103348163
   04147 Exosome [BR:ocu04147]
    103348163
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Others
   WASH complex
    103348163
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     103348163
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103348163
SSDB
Motif
Pfam: F_actin_cap_B
Other DBs
NCBI-GeneID: 103348163
NCBI-ProteinID: XP_008254178
LinkDB
Position
3:complement(135059883..135083360)
AA seq 319 aa
MEACGHADAFGPVVIVLKALGQRSSPRPHPAASEGQGQACTGRLSHLSFRPGLAPVRRPP
PQGEGRGGADGQRLYAYGGGRGGADRALAGFMQTPEFRQRNGGKQASEPEQGCDWALCGE
MALCGRGCGLLGLCCFLFKASTRSFLSASCLEANNAFDQYRDLYFEGGVSSVYLWDLGHG
FAGVILIKKAGGGSKKIKGCWESIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTM
NLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSMLNEIYFGKTKDIVNGLRSVQ
TFADKSKQEALKNDLVIMY
NT seq 960 nt   +upstreamnt  +downstreamnt
atggaggcttgtggtcatgctgatgctttcggtcctgttgtgattgtgttaaaagcactt
ggccagaggagcagcccccgcccccaccccgcggcctccgagggacaggggcaagcctgc
acaggacggctgagccacctctccttccgcccagggctggcccctgtccgccgacctccg
ccccaaggggaggggaggggaggggctgacggacagcgtctttatgcctatggggggggg
cggggcggggcggaccgggccctcgcgggctttatgcagacaccggagttccgacagcgg
aacggtgggaagcaggcctcggagccggagcagggctgtgactgggctttatgcggggag
atggcgctgtgcggtagaggatgtgggttgttagggctctgctgctttctcttcaaagcc
tccaccaggtcgttcttaagcgcttcttgtttagaagccaacaatgcctttgaccagtac
cgagacctgtattttgaaggtggtgtctcatctgtctacctctgggatctgggtcatggc
tttgcgggagtgatcctcataaagaaggctggaggtggatcaaagaagatcaaaggctgc
tgggagtccatccacgtggtggaagtgcaggagaagtccagtggccgcaccgcccactac
aagctgacttccacggtgatgctgtggctgcagaccaacaaatccggctcgggtaccatg
aacctcggaggcagccttaccagacagatggagaaagatgagactgtgagtgactgctcc
ccacacatagccaacatcgggcgcctggtagaggacatggaaaataaaatccgaagtatg
ctgaatgagatctactttgggaaaacgaaggacatcgtcaacgggcttaggtctgtgcag
acttttgcagacaaatctaaacaagaagcgcttaagaacgacctggtaattatgtattaa

DBGET integrated database retrieval system