KEGG   Oryctolagus cuniculus (rabbit): 100346017
Entry
100346017         CDS       T03373                                 
Symbol
WASHC1, WASH1
Name
(RefSeq) WASH complex subunit 1
  KO
K18461  WAS protein family homolog 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100346017 (WASHC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100346017 (WASHC1)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Others
   WASH complex
    100346017 (WASHC1)
SSDB
Motif
Pfam: WASH_WAHD DUF4208 WH2
Other DBs
NCBI-GeneID: 100346017
NCBI-ProteinID: XP_002712809
Ensembl: ENSOCUG00000024750
LinkDB
Position
8:28917990..28928186
AA seq 471 aa
MTPMRTQPSLAGQTYAVALIQPDLRREEAIQQVADALQYLQKVSGDIFSRISQRVELSRS
QLQAIGQRVSLAQAKIEKIKGSKKAIKVFSSAKYPAPERLQEYGSIFSGAQDPGLQGRPR
HRIQSKHRPLDERALQEKLKYFPVCVSTKPGPEDEAEEGLGGLPSNISSVSSLLLFNTTE
NLYKKYVFLDPLAGAVTKTHVMLGAETGEKLFDAPLSISKREQLERQVPENYFYVPDLGQ
VPEIDVPSYLPDLPGIADDLMYSADLGPGIAPSAPGAIPELPTFHTEVVEPFKPDLEDGV
LTAPPPPPPPPPPPPAPAVLVSAPPPPPQTVASTGQGARVDDSGSSGPPAAVQGAPKEVV
DPSSGRATLLESIRQAGGIGKAKLRSVKERKLEKKKQKEREQVRATSQSGDLMSDLFNKL
VMRRKGISGKGPGTGASEGPGGAFARMSDSIPPLPPPQQPAGEDDEDDWES
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgactcccatgaggacgcagcccagcctggccggccagacctacgcggtggccctcatc
cagccggacctgcggcgcgaggaggccatccagcaggtggcagacgccctgcagtacctg
cagaaggtctctggtgatatctttagcagaatctcccagcgagtggagctgagccggagc
cagctgcaggccatcgggcagagggtctccttggcccaggccaagattgagaagatcaag
ggcagcaagaaggccatcaaggtgttctccagtgccaagtacccagctcccgagcggctg
caggaatatggctccatcttctcgggcgcccaggaccctggcctgcaggggcggccccgc
cacaggatccagagcaagcaccgccccctggatgagcgggccctgcaggagaagctgaaa
tacttccccgtgtgtgtgagcaccaagcccggacctgaggatgaagccgaggaggggctc
gggggccttcccagcaacatcagctccgtcagctccttgctgctcttcaacaccaccgag
aacctgtacaagaaatacgtcttccttgacccgctggccggtgctgtgaccaagacccat
gtgatgctgggggcagagacaggggagaagctattcgatgcgccactgtccatcagcaag
agagaacagctagagcgacaggttccagagaactacttctatgtgccagacctgggccag
gtgcccgagatcgatgtgccttcctacctgccggacctgcccggcatcgctgatgacctc
atgtacagcgccgacctgggccccggcattgccccctcggcccccggcgctattccagag
ctgcccaccttccacacggaggtggtggagcctttcaagccagacctggaggatggggtg
ctcacagcacccccaccaccccctccacccccgccacctcccccagcacctgcggttctg
gtcagtgccccaccaccacctccccagacagtggcctccaccggccaaggtgccagggta
gatgacagcggcagcagtgggcctccagcggcagtccagggagctcccaaagaagtggtc
gacccctccagcggccgggccaccctgctggagtccatccgccaagccggcggcatcggc
aaggctaagctgcgcagcgtcaaggagcgcaagctggagaagaagaaacagaaggagcgg
gagcaagtgagagccacgagccagagtggggacctgatgtcggatctctttaacaagctg
gtcatgagacgcaaaggcatatctgggaaaggacctgggacaggggccagcgaggggcct
ggaggagccttcgcccgaatgtctgattccattcctcctctgcctcctccccagcagcca
gcgggagaggacgacgaagatgactgggagtcttag

DBGET integrated database retrieval system