KEGG   Oryctolagus cuniculus (rabbit): 100346051
Entry
100346051         CDS       T03373                                 
Symbol
OTUD5
Name
(RefSeq) OTU deubiquitinase 5
  KO
K12655  OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100346051 (OTUD5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100346051 (OTUD5)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100346051 (OTUD5)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100346051 (OTUD5)
Peptidases and inhibitors [BR:ocu01002]
 Cysteine peptidases
  Family C85
   100346051 (OTUD5)
Ubiquitin system [BR:ocu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    100346051 (OTUD5)
SSDB
Motif
Pfam: OTU Peptidase_C65
Other DBs
NCBI-GeneID: 100346051
NCBI-ProteinID: XP_002719950
Ensembl: ENSOCUG00000015767
UniProt: G1TA62
LinkDB
Position
X:complement(33575424..33606881)
AA seq 566 aa
MTILPKKKPPPPDADPTNEPPPSGPLPPAPRRGGGVGVGGGGTGVGGGDRDRDSGVVGAR
PRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAA
AAGVGAAGVVVGVGGAVGVGGCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYNSEDE
YEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMH
EVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQ
YSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPGFAEQSLM
KNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQVRGPS
QPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGIKPPSPGTVLALA
KPPSPCAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDEILASV
LAVSQQEYLDSMKKNKVHRDPPPDKS
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgactattctccccaaaaagaagccgccgcctcccgacgccgaccccaccaacgagccg
ccgccgtccgggcctctgcccccggcgccgcgccgcggcgggggtgtgggcgtgggcggc
ggcggcacgggtgtgggtggcggcgatcgcgaccgtgactcgggtgtcgtaggggcccgt
ccccgggcttcgccgccgcctcagggcccgctcccggggccgccgggcgcgcttcaccgc
tgggcattagccgtgccaccaggcgcagtggcggggcctcggccacagcaggcctctcca
cctccttgtgggggccctggtggtcccggcggcggtcccggtgatgcactgggtgcagca
gcggcgggcgtaggcgcggcgggcgtggtggtgggcgtaggtggtgctgtgggcgtgggt
ggctgctgctcagggccaggacacagcaagcggcggcgtcaggctcctggggttggcgcc
gttggtgggggcagcccggagcgtgaggaggtcggcgcgggctacaacagtgaggacgag
tatgaagcagcagccgcacgcattgaggccatggaccctgctacggtcgagcagcaggaa
cactggtttgaaaaggccctgcgagacaagaaaggcttcatcatcaagcagatgaaggaa
gacggcgcctgtcttttccgggctgtagctgaccaggtgtatggagaccaggacatgcat
gaggttgtacgaaagcactgcatggactatctgatgaagaatgccgactacttttccaat
tatgtcacagaggacttcaccacctacatcaaccgcaagcggaaaaacaactgccatggc
aaccacattgagatgcaggccatggcagagatgtataaccgtcccgtggaggtgtaccaa
tacagcacagaacctatcaacacattccatgggatccatcaaaatgaggatgagcccatc
cgggtcagctaccatcggaatatccattataattcagttgtgaatcctaacaaggccacc
attggtgtggggctgggcctgccatcattcaaaccagggtttgcagagcagtccctgatg
aagaatgccataaagacatcggaggagtcatggattgaacagcagatgctggaagacaag
aaacgtgctacagactgggaggccacaaatgaggccattgaggagcaagtagctagggaa
tcctaccttcagtggctgcgagatcaggagaaacaggcccgccaggtccgcggccccagc
cagccccggaaagcgagcgccacgtgcagttcagccacagcagcagcctccagtggcctg
gaggagtggaccagtcggtccccgcggcagcggagttcggcctcatcccccgagcaccct
gagctgcacgccgagctaggcatcaaacccccttccccaggcactgtcttagctcttgcc
aaacctccttcaccctgcgcaccaggtacaagcagtcagttctctgcaggggccgaccgg
gccacttcccccctcgtgtccctctatcctgctctggaatgccgggctctcattcagcag
atgtccccctctgcctttggtctgaatgactgggatgatgatgagatcctagcttcggtg
ctggcagtgtcccaacaggaatacctagacagtatgaagaaaaacaaagtgcacagagac
ccacccccggacaagagctga

DBGET integrated database retrieval system