Oryctolagus cuniculus (rabbit): 100346065 Help Entry 100346065         CDS       T03373                                  Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04810   Regulation of actin cytoskeleton ocu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ocu00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100346065  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100346065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  100346065 NCBI-ProteinID:  XP_002722494 Ensembl:  ENSOCUG00000032574 UniProt:  A0A5F9C4F5 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcggggcaagaggatccggtgcagcgggagattcaccaggactgggcgaaccgggag tacattgaggtcatcaccagcagcatcaagaaaatcgcggactttctcaattcgttcgat atgtcttgtcgttcgcgactggccacactaaacgagaaattgactgcgcttgagcggagg atagagtacatcgaagcccgggtgacaaaaggagagacgctgacctag

DBGET integrated database retrieval system