KEGG   Oryctolagus cuniculus (rabbit): 100346186
Entry
100346186         CDS       T03373                                 
Symbol
CX3CL1
Name
(RefSeq) C-X3-C motif chemokine ligand 1
  KO
K05508  C-X3-C motif chemokine 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04668  TNF signaling pathway
ocu05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100346186 (CX3CL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100346186 (CX3CL1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100346186 (CX3CL1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100346186 (CX3CL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100346186 (CX3CL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100346186 (CX3CL1)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100346186 (CX3CL1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100346186
NCBI-ProteinID: XP_002711587
Ensembl: ENSOCUG00000007482
UniProt: G1ST53
LinkDB
Position
5:13525844..13539039
AA seq 404 aa
MAPIAPQWLLRLAAFCPLMVPLAGQHLGVAKCSIICNNMTPKIPVALLISYQWNQESCGK
PAIVLETKRHKRFCADPQAPWVQEAMKHLDRQAVARTPNSGTFEKQIGAVKPGASTVKPG
TTAAPGGMPEPAVSEPRPTGDSRSPEPTPAPQEAQTTLGTSPALPAGVPSSSGSGSLVTQ
KPQDGRPPVGPTGPEFVNTAPVSTAGSWQTSAHQHGATESPSAETPSTEHPSTQALTTSY
PASEENLGSESQSPGAPALSPRPGDPQSTWETVPVVAHTGAFQDGGAGSTAYASVVPGSS
EGTPSREPAASGSWTPKAEEPVHATVDPQRLGVLITPVPDSQAATRRQAVGLLAFLGLLF
CLGVAMFAYQSLQGCPRKMAGEMVEGLRYVPRSCGANSYVLVPV
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggctcccatcgctccccagtggctgctgcgtttggctgctttctgcccactgatggtc
ccgctggctggacagcaccttggggtggcgaaatgcagcatcatatgcaacaacatgacc
ccgaagatccccgtggctttactcatcagctatcagtggaaccaggaatcttgtggcaaa
cccgccattgtcttggagacgaagaggcacaagcgcttctgtgctgacccccaggcgcca
tgggtccaagaagctatgaaacaccttgaccgccaggctgttgctcggaccccaaacagc
ggcacattcgagaagcagattggcgcagtgaagcccggtgccagcacggtgaagccaggg
accacggcagctcccggcgggatgcccgaacctgcggtctcagagcccagacccacgggg
gacagcaggagccccgagccgactcccgctccccaggaggcacagacgaccctggggacc
tccccagcactgcctgctggggtgccgagctcctcagggagtggctcccttgtcactcag
aagcctcaggacggaaggcccccagtggggcccacgggtcctgagtttgtcaacacggcc
cctgtctccaccgccggctcttggcagacttctgcacaccagcacggggccaccgagtcc
ccctctgctgagacgccctccacagagcacccctccactcaggccctcaccacctcatac
ccagcctcagaggagaaccttgggtctgaaagccaatctccaggggcccctgcactgagc
cccaggccaggggaccctcaaagtacctgggagacagtgcccgtggttgctcacacgggt
gccttccaggatgggggtgctggcagcacggcctacgcttctgtggtccctggctcctct
gaagggacccccagcagggagcctgcggcctcaggcagctggacccccaaggccgaggag
cccgtccatgccactgtggacccccagaggctgggcgttctcatcactcctgtccctgac
tcccaggcggccacccggaggcaggcggtggggctgctagccttcctcggcctcctcttc
tgcctgggggtggccatgttcgcctaccagagcctgcagggctgcccccgcaagatggcg
ggggagatggtggaaggcctgcgctatgtgccccggagctgtggcgccaactcctatgtc
ctggtgccggtttga

DBGET integrated database retrieval system