KEGG   Oryctolagus cuniculus (rabbit): 100346441
Entry
100346441         CDS       T03373                                 
Symbol
EIF3E
Name
(RefSeq) eukaryotic translation initiation factor 3 subunit E
  KO
K03250  translation initiation factor 3 subunit E
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100346441 (EIF3E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ocu03012]
    100346441 (EIF3E)
   03051 Proteasome [BR:ocu03051]
    100346441 (EIF3E)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100346441 (EIF3E)
Translation factors [BR:ocu03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    100346441 (EIF3E)
Proteasome [BR:ocu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100346441 (EIF3E)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100346441 (EIF3E)
SSDB
Motif
Pfam: eIF3_N PCI CSN8_PSD8_EIF3K VMAP-M1
Other DBs
NCBI-GeneID: 100346441
NCBI-ProteinID: XP_002710778
Ensembl: ENSOCUG00000008050
LinkDB
Position
3:complement(123577973..123623596)
AA seq 445 aa
MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKN
LYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK
HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ
NWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQP
QYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLY
VNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKL
NMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAM
NIEKKLNQNSRSEAPNWATQDSGFY
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggcggagtacgacttgactactcggatcgcgcactttttggaccggcatctggtcttt
ccgctgcttgagttcctctccgtaaaggagatatataatgaaaaagaattactacaaggg
aagttggatcttcttagtgataccaacatggtagactttgctatggatgtatacaaaaac
ctttattcagatgatattcctcatgctttgagagaaaaaagaaccacagttgttgcacaa
ctgaaacagcttcaggcagaaacagaaccaattgtgaagatgtttgaagatccagaaact
acaaggcaaatgcagtcaaccagggatggtcgaatgctgtttgattacctggcagacaag
catggatttaggcaagaatatttagatacactctataggtatgcaaaattccagtatgaa
tgtgggaattattctggagcagcagaatatctttacttttttagagtattggttccagca
acagatagaaatgctttaagttcactctggggaaaactggcttctgaaattttaatgcag
aattgggatgcagccatggaagatcttacacgattaaaagagaccatagataacaattct
gtgagttctccactccagtctcttcagcagcgaacttggctcattcattggtctctgttt
gttttcttcaaccacccgaaaggtcgagataacattatcgatctcttcctttaccagcca
cagtatcttaatgcaattcagacaatgtgtccacatattctgcgttatttgaccacagca
gtcataacaaacaaagatgttcgaaaacgccggcaggtgctgaaagatcttgtcaaagtt
attcaacaggaatcttacacctataaagacccaattacagaatttgttgaatgcttatat
gttaactttgactttgatggggctcagaaaaagctgagggaatgtgaatcagtgcttgtg
aatgatttctttttggtggcttgtcttgaagatttcattgaaaatgcccgtcttttcata
tttgagactttttgtcgcatccaccagtgtatcagcattaatatgttggcagataaactg
aacatgactccagaggaagctgaaaggtggattgtgaatttgattaggaatgcaagactg
gatgccaagattgattccaaattaggccacgtggttatgggaaacaatgcagtctcaccc
tatcagcaagtgattgaaaagaccaaaagcctttcttttagaagccagatgttggccatg
aatattgagaagaaacttaatcagaatagtaggtcagaggctcctaactgggcaactcaa
gactctggcttctactga

DBGET integrated database retrieval system