KEGG   Oryctolagus cuniculus (rabbit): 100346504
Entry
100346504         CDS       T03373                                 
Symbol
NEO1
Name
(RefSeq) neogenin 1
  KO
K06766  neogenin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04350  TGF-beta signaling pathway
ocu04360  Axon guidance
ocu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100346504 (NEO1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100346504 (NEO1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100346504 (NEO1)
SSDB
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig Pur_ac_phosph_N V-set Interfer-bind C2-set_2 Ig_5 fn3_2 Tissue_fac Ig_4 SusE EphA2_TM Cadherin_C_2 SARAF Herpes_UL74 FAM176
Other DBs
NCBI-GeneID: 100346504
NCBI-ProteinID: XP_017194041
LinkDB
Position
Un
AA seq 1561 aa
MSDKPCSVHFAQFSSGLGQEVGRGLAVVSSPPLTLFMPRSSITSQLHKGTLEDNENEANK
YPRNQDPGEEYRTVSVQRQQRERGSDSRGKPVVTTQHALACPSFLRFPSCFHWEVKFCTC
SCVSCRKSRGKCRSALCFGFVSVGAGVRTFTPFYFLVEPVDTLSVRGSSVILNCSAYSEP
LPKIEWKKDGTFLNLVSDDRRQLLPDGSLFISNVVHSKHNKPDEGYYQCVATVESLGTIV
SRTAKLTVAGLPRFISQPEPSSAYAGNSAVLNCEVNADLAPFVRWEQDRQPLLLDDRVAK
LPSGALVISNVTEADGGLYRCVVDSGGGPPKFSDEAELKVLADPEVPSDLVFLKQPPSLV
RAVGQSVVLPCVASGLPAPSIRWLKNEEALDTDSSERLVLLAGGSLEISEVTQDDAGTYS
CVAGSGNETIEAQAELTVQAPPEFLKRPASLYAHESMDIVFECEVTGKPAPTVKWVKNGD
VVIPSDYFKIVKEHNLQVLGLVKSDEGFYQCIAENDVGNAQAGAQLVILEHAPATTGPLP
SAPRDVVASLVSTRFIKLTWRTPASDPQGDSLTYSVFYTKEGTARERVENTSRPGEMQVT
IQNLMPATVYIFRVTAQNRHGSGESSAPLRVETQPEVQLPGPAPNIRAYATSPTSITVTW
ETPLSGNGEIQNYKLYYLEKGTDKEQDIDVSSHSYTLNGLKKHTEYTFRVVAYNKHGPGV
STQDVTVRTLSDVPSAAPQNLSLEVRNSKSIVVHWQPPPPATQNGLISGYKIRYRKASRK
SDVTETLVVGTQLSQLIEGLDRGTEYNFRVAALTINGTGPATDWLSAETFESDLDETRVP
EVPSSLHVRPLVTSIVVSWTPPENQNIVVRGYAIGYGIGSPHAQTIKVDYKQRYYTIENL
DPSSHYVITLKAFNHVGEGIPLYESAVTRPHTDTSEVDLFVVNAPYTPVPDPTPMMPPVG
VQASILSHDTVRVTWADNSLPKHQKITDSRYYTVRWKTNIPANTKYKNANATTLSYLVTG
LKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFELVPTSPPKDVTVVSKEGKPRTIIVNWQP
PSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKG
MGPMSEAVQFRTPKADSSDKMPNDQASGSAGKGSRLPDLGSDYKPPVSGSNSPHGSPTSP
LDSSVLLVLIVSVGVVTVVAVVVVAVFCTRRTTSHQKKKRAACKSVNGSHKYKGNAKDVK
APGPVDPPRKAGAEAHRQSPDPNPIMTDTPIPRHSQDTTPAGTSSDGSTHQRRNSYRGHE
SEDSMSTLAGRRSMRPKMMMPFDSQPPQRVISAHPIHSLDNPHIISLSSLASAARSHLHH
PGSPWPVATSMSLSDRANSTESVRNTPSTDTMPASSSQTCCADHQDPEGATSSSYLASSQ
EEDSGQGLPTAHVRPSHPLKSFAVPAVPPPGPPTYDPALPSTPLLSQQALNHHLHAVKTA
SIGTLGRSRPPMPVVVPSAPEVQETTRMLEDSESSYEPDELTKEMAHLEGLMKDLNAITT
A
NT seq 4686 nt   +upstreamnt  +downstreamnt
atgtcggacaagccttgttccgttcattttgcccagttttccagtggtctcgggcaggag
gttggccgcggtctggctgttgtctccagtcctccactgacgctgtttatgcctaggtcg
tcgataacttcccagctgcacaagggcactttggaagacaacgaaaatgaagcaaacaag
tatccgaggaatcaggatcccggtgaagagtacaggacggtgtccgtgcagaggcagcaa
agggagcgagggtctgatagccggggaaagccggtggtcaccacgcagcatgccctggcc
tgcccttcctttctcaggtttccaagctgcttccattgggaagttaagttttgcacttgt
tcttgtgtttcctgcagaaaaagtagaggaaagtgtcgctcagcactgtgctttggcttt
gtctctgtaggagccggtgttcggacgttcactccgttttatttcctcgtggagccagtg
gacacactctccgtcagaggctcatctgtcatattaaactgctctgcgtattctgaaccg
cttccgaaaatcgaatggaaaaaagatgggacgttcttgaacttagtgtcagatgatcga
cgccagcttctcccagacgggtctttatttatcagcaacgtggtgcattccaagcacaat
aaacccgatgaaggttattaccagtgcgtggccactgttgagagccttgggactattgtg
agcagaacagccaagctcacggtagcaggtcttccaagatttatcagccagccagagcct
tcctcagcttacgctggaaacagtgccgtcctgaattgcgaagtgaatgcagatttggcc
cccttcgtgaggtgggaacaggacagacagccccttcttctggatgacagagtcgccaag
cttcctagcggggcactggtcatcagcaacgtgaccgaggcagacgggggcctttaccgc
tgcgtggtcgacagcggcggcgggccacccaagttcagtgacgaagcggaactgaaggtt
cttgcagatcctgaggtgccgtcagacttggtgtttctgaagcagccgccttccttggtc
agagccgttggtcagagcgtggtgttgccttgtgttgcctcgggactgcctgctcccagc
atcagatggttgaaaaatgaggaggcactcgacacagacagttctgagagactggtcctc
ctggcagggggtagcctggagatcagtgaagtcactcaggacgatgccgggacttactcc
tgcgtagcgggcagtggcaacgagacgatcgaagctcaggcggagctcacagtacaagct
ccccccgagttcctcaagcgaccggccagtctgtatgctcacgagtccatggatatcgtg
ttcgagtgtgaagtgactgggaaaccagctccaactgtgaagtgggtcaaaaatggggac
gtggtgatcccaagtgattacttcaagattgtaaaggaacacaacctgcaggttttaggg
ctggtgaagtcggatgaagggttctatcagtgcattgctgagaacgatgttgggaacgcg
caggctggagcccagctggtcatcctggagcatgcgccagccacgacgggaccactgccc
tcggctcctcgggatgtcgtggcctccctggtctcgacccgctttatcaagctgacgtgg
cggacgcctgcgtcggaccctcagggagacagcctcacctactctgtgttctacaccaag
gaggggactgctcgggagcgtgttgaaaataccagtcgcccaggagagatgcaagtaacc
attcagaacctaatgccagcgacggtgtacatcttcagagtcacggctcaaaacaggcat
ggctctggcgagagttcggccccgctgcgtgtggaaacgcagcctgaagtccagctccct
ggcccagcacctaacatccgagcgtacgcgacgtcccctacctccatcactgtcacctgg
gagacgccgttgtctggcaatggagagattcagaactacaaattgtactacctggaaaag
gggacggacaaggaacaggacatcgacgtttcaagtcactcctacacccttaacgggctg
aaaaagcataccgagtacaccttccgagtggtggcctacaataagcacggccccggggtg
tccacgcaggacgtcactgtgcggaccctgtcagacgttcccagtgctgctcctcagaat
ctgtctttagaagtgagaaactcaaagagcatcgtggttcactggcagccccctccccca
gccacacagaacgggctcatctctggctacaagattcgctaccgaaaggcttcccgaaag
agtgatgtgaccgagaccttggtagtgggaacgcagctgtctcagctgattgaaggtctc
gatcggggtactgaatataacttccgagtggctgctctaacgatcaacggtacaggcccg
gcgactgactggctctctgctgaaacctttgaaagtgacttggatgaaacccgtgttccc
gaggtacccagctctcttcatgtccgccccctcgtaactagcatcgtcgtgagctggacg
ccgcctgagaaccagaacattgtggtcagaggctatgccatcgggtatggcattggcagt
ccccacgcccagaccatcaaggtggactataaacagcgctattacaccatcgagaatctc
gacccgagctcgcactatgtgatcacgctgaaagcgttcaaccacgtgggcgaaggcatc
cccctgtacgagagtgccgtgaccaggcctcacacagacacttctgaggttgatttattt
gttgttaatgctccatacaccccagtgccagatcccacccccatgatgcctcccgtggga
gttcaggcttccatcctgagtcatgacaccgtcagggtcacgtgggcagacaactcgctg
cccaaacaccagaagatcaccgactcccgctactacacggtgcggtggaaaaccaacatc
ccggcaaacaccaagtacaagaatgcaaatgcgacaactttgagttacctggtgactggt
ttaaaaccaaacaccctgtacgaattctctgtgatggtgaccaaaggtcgaaggtcaagc
acgtggagtatgacagcccatggaaccacctttgagttggttcctacttctccgcccaag
gatgtgaccgttgtgagtaaggagggcaaacccagaaccataattgtgaactggcagcct
ccttcggaagccaacggcaaaattacaggttacatcatctattacagcacggacgtgaat
gccgagatccacgactgggtcattgaacccgtcgtggggaacaggctgactcaccagatc
caggagctgacgctcgacacgccgtactacttcaagatccaggcccgcaactccaagggc
atggggcccatgtctgaggccgtccagttcaggacccctaaagcggactcctctgataaa
atgcccaatgaccaagcctcagggtctgcgggaaaaggaagccggctgccagacctggga
tccgactacaagcctccagtgagcggcagcaacagccctcacgggagccccacctccccg
ctggacagcagcgtgctgctggtgctcatcgtctccgtgggcgtcgtcaccgtcgtggcg
gtcgtggtcgtcgccgtcttctgcacgcggcgcaccacctctcaccagaagaagaaacgc
gctgcctgcaaatccgtgaacggctcccacaagtacaaagggaacgccaaggacgtgaaa
gcccccggacctgtggatccaccacgaaaggctggagctgaagcccatcgccagtctcca
gaccccaaccccatcatgacggacacgccgattcctcggcactcgcaggacaccacgccg
gcgggcacgtcctcggacggcagcacccaccagaggcggaattcctaccgagggcacgag
tcagaggacagcatgtctacactggctggaaggcggagcatgagaccaaaaatgatgatg
ccgtttgactcccagccgccccagcgcgtgattagtgctcatcccatccattccctcgat
aaccctcacatcatttcactcagcagcctcgcttccgcagcccgcagccacctccaccac
ccaggcagcccatggcccgtggccacatccatgtccctttcagacagggccaattccaca
gagtccgtgcgcaacacacccagcaccgacaccatgccagcctcctcgtcccagacgtgc
tgtgccgaccaccaggacccggaaggtgctaccagctcctcctacttggccagctcccaa
gaggaggattcgggccagggtcttcccacggcccacgtccgcccttcccacccgctgaag
agcttcgcggtgccggcagtcccgccgccggggccccccacctatgatcccgcgttgcca
agcacaccgttactgtcccagcaagctctgaaccaccaccttcacgccgtgaagacggcc
tccatcgggactctgggaaggagccggcctcctatgcccgtggtggttcccagtgccccc
gaggtgcaggagaccacccggatgctggaagactccgagagtagctacgaaccagatgag
ctgaccaaagagatggcccacctggaaggactcatgaaggacctgaacgctatcacgacc
gcgtga

DBGET integrated database retrieval system