KEGG   Oryctolagus cuniculus (rabbit): 100346624
Entry
100346624         CDS       T03373                                 

Symbol
LTBR
Name
(RefSeq) lymphotoxin beta receptor
  KO
K03159  lymphotoxin beta receptor TNFR superfamily member 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04064  NF-kappa B signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu05166  Human T-cell leukemia virus 1 infection
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100346624 (LTBR)
   04066 HIF-1 signaling pathway
    100346624 (LTBR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100346624 (LTBR)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100346624 (LTBR)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100346624 (LTBR)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100346624 (LTBR)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100346624 (LTBR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100346624 (LTBR)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100346624 (LTBR)
SSDB
Motif
Pfam: TNFR_c6 Ephrin_rec_like NCD3G
Other DBs
NCBI-GeneID: 100346624
NCBI-ProteinID: NP_001254634
Ensembl: ENSOCUG00000001292
UniProt: G1SF49
LinkDB
Position
8
AA seq 414 aa
MRPPWAASDRGLAWGPLVLGLCGLLAASQPQLIPPYGSENQTCWDQEKEYYEPKHQLCCS
RCPPGTYVKAECNHSQDTTCATCAENSYNEHWNHLSICQLCRPCDSVLGFQEIAPCTSKQ
KTQCRCQPGMFCAHWALECVYCEPLSECPPGTEAELKGEVPEANNNCVPCKEGYFQNTSS
SSARCQPHTRCEDLGLVEAVPGTTQSDRTCQDPPEPLPGTVLVLAILLPLVSFLLLTILA
CTWKSLPSLCRKLGSLLKRHPEGEESPSCPPPRVNPHFPDLVEPLLPVSGDLSQASAGAP
AAPGLEEVVLQQQSPLSQTRELEAEPGEQGQVAHGANGIHVTGGSVTVTGNIYIYNGPVL
GGARGPGDPPAPPEPPYPIPEEGAAGPPGLSTPYQEDGKAWHLAETETLGCHSL
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgcgcccgccttgggccgcctctgaccgcggcctggcgtgggggcccctggtgctgggc
ctctgcggactcctggctgcatcccagccccagctgatacccccgtacggctccgagaac
caaacctgctgggaccaggaaaaggagtactacgaacccaagcaccagctctgctgttcc
cgctgccccccaggcacctatgtcaaagccgaatgcaatcacagccaggacacgacttgt
gccacgtgtgccgagaactcctacaacgagcactggaaccacctgtccatctgccagctg
tgccgaccctgtgactctgtgctgggcttccaggagatcgcgccgtgcaccagcaagcag
aaaacccagtgccgctgccagcccgggatgttctgcgcccactgggcccttgagtgtgtg
tactgcgagccgctttcagagtgcccgcctggcactgaggctgagctcaaaggtgaagtg
cccgaggccaacaacaattgcgtcccctgcaaggaaggctacttccagaacacctcctcc
tccagcgctcgctgccagccccacaccaggtgtgaggacctcggcttggtggaggcagtc
ccaggcaccacccagtccgacaggacatgccaagacccacccgagccgttgccagggacc
gtgctggtgctggccatcctgctgccgctggtgtcctttctgctcctcaccatcctcgcc
tgcacctggaagagcctcccctccctctgcaggaagctgggatccctgctcaagaggcac
ccggagggagaggaatccccctcctgcccccctccaagggtcaacccacacttccctgac
ctggtggagccgcttctgcccgtctctggagacttgtctcaggcctctgccggagccccg
gccgccccgggcctggaggaagtggtgctacagcagcagagtcccctgagccagaccaga
gagctggaggctgagcctggggagcagggccaggtggcccacggtgccaatggcattcat
gtcaccggtggctctgtgactgttactggcaacatctacatctacaacgggccagtgcta
gggggagcgcggggccctggggacccgccggctccccccgagcctccgtaccctattccc
gaagagggcgctgcaggccctcccgggctctctacaccctaccaggaagacggcaaagct
tggcacctggccgagacagagacactgggctgccactccctctga

DBGET integrated database retrieval system