Oryctolagus cuniculus (rabbit): 100346703 Help Entry 100346703         CDS       T03373                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04068   FoxO signaling pathway ocu04136   Autophagy - other ocu04140   Autophagy - animal ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     100346703  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100346703    04136 Autophagy - other     100346703  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100346703    04622 RIG-I-like receptor signaling pathway     100346703  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100346703    04121 Ubiquitin system [BR:ocu04121]     100346703    03029 Mitochondrial biogenesis [BR:ocu03029]     100346703 Membrane trafficking [BR:ocu04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     100346703 Ubiquitin system [BR:ocu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    100346703 Mitochondrial biogenesis [BR:ocu03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     100346703 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 UCH_C Motif Other DBs NCBI-GeneID:  100346703 NCBI-ProteinID:  XP_002712088 Ensembl:  ENSOCUG00000029145 UniProt:  A0A5F9CV69 LinkDB All DBs Position 7:45431546..45432259 Genome browser AA seq 141 aa AA seqDB search MAEEPEAVLPLPPLAAAAGGEGLPEGSPETATPEPPSSAAVSPGTEEPPGDTKKKIDILL KAVGDTPIMKTKKWAVERTRTIQGFIDFIRKFLKLMASEQLFIYVNQSFAPSPDQEVGTL YECFGSDGKLVLHYCKSQAWG NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atggcggaggagccggaggcagtgttgcctcttcctccgctcgctgctgctgctggcggc gaaggactcccggagggctccccagaaacagccacgccggagcccccttcttccgctgct gtctccccggggacggaagagcctcctggcgacaccaagaagaaaatcgacatcctgctg aaggctgtgggagatacccctattatgaaaaccaagaaatgggctgtagagcgaacaaga accatccaaggattcattgatttcatcagaaagttccttaagcttatggcctcagaacag ttgtttatttatgtgaaccagtcctttgctccttccccagaccaagaagttggaactctg tatgagtgtttcggcagtgatggcaaactggtcctgcattactgcaagtcgcaggcgtgg ggatga

Oryctolagus cuniculus (rabbit): 103347845 Help Entry 103347845         CDS       T03373                                  Symbol ATG12 Name (RefSeq) autophagy related 12   KO K08336   ubiquitin-like protein ATG12 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04068   FoxO signaling pathway ocu04136   Autophagy - other ocu04140   Autophagy - animal ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     103347845 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103347845 (ATG12)    04136 Autophagy - other     103347845 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103347845 (ATG12)    04622 RIG-I-like receptor signaling pathway     103347845 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     103347845 (ATG12)    04121 Ubiquitin system [BR:ocu04121]     103347845 (ATG12)    03029 Mitochondrial biogenesis [BR:ocu03029]     103347845 (ATG12) Membrane trafficking [BR:ocu04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     103347845 (ATG12) Ubiquitin system [BR:ocu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    103347845 (ATG12) Mitochondrial biogenesis [BR:ocu03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     103347845 (ATG12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  103347845 NCBI-ProteinID:  XP_008253136 LinkDB All DBs Position 3:complement(621952..633154) Genome browser AA seq 142 aa AA seqDB search MAEEPEAVLPLPPLAAAAAGGEGLPEGSPETATPEPPSSAAVSPGTEEPPGDTKKKIDIL LKAVGDTPIMKTKKWAVERTRTIQGLIDFIRKFLKLMASEQLFIYVNQSFAPSPDQEVGT LYECFGSDGKLVLHYCKSQAWG NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atggcggaggagccggaggcagtgttgcctcttcctccgctcgctgctgctgctgctggc ggcgaaggactcccggagggctccccggaaacagccacgccggagcccccttcttccgct gccgtctccccggggacggaagagcctcctggcgacaccaagaagaaaatcgacatcctg ctgaaggctgtgggagatacccctatcatgaaaaccaagaagtgggctgtagagcgaaca agaaccatccaaggactcattgatttcatcagaaagttccttaagcttatggcctcagaa cagttgtttatttatgtgaaccagtcctttgctccttccccagaccaagaagttggaact ctgtatgagtgtttcggcagtgatggcaaactggtcctgcattactgcaagtcgcaggcg tggggatga

DBGET integrated database retrieval system