KEGG   Oryctolagus cuniculus (rabbit): 100346703
Entry
100346703         CDS       T03373                                 
Name
(RefSeq) ubiquitin-like protein ATG12
  KO
K08336  ubiquitin-like protein ATG12
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04068  FoxO signaling pathway
ocu04136  Autophagy - other
ocu04140  Autophagy - animal
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100346703
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100346703
   04136 Autophagy - other
    100346703
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100346703
   04622 RIG-I-like receptor signaling pathway
    100346703
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100346703
   04121 Ubiquitin system [BR:ocu04121]
    100346703
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100346703
Membrane trafficking [BR:ocu04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    100346703
Ubiquitin system [BR:ocu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   100346703
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100346703
SSDB
Motif
Pfam: APG12 ATG8 UCH_C
Other DBs
NCBI-GeneID: 100346703
NCBI-ProteinID: XP_002712088
Ensembl: ENSOCUG00000029145
UniProt: A0A5F9CV69
LinkDB
Position
7:45431546..45432259
AA seq 141 aa
MAEEPEAVLPLPPLAAAAGGEGLPEGSPETATPEPPSSAAVSPGTEEPPGDTKKKIDILL
KAVGDTPIMKTKKWAVERTRTIQGFIDFIRKFLKLMASEQLFIYVNQSFAPSPDQEVGTL
YECFGSDGKLVLHYCKSQAWG
NT seq 426 nt   +upstreamnt  +downstreamnt
atggcggaggagccggaggcagtgttgcctcttcctccgctcgctgctgctgctggcggc
gaaggactcccggagggctccccagaaacagccacgccggagcccccttcttccgctgct
gtctccccggggacggaagagcctcctggcgacaccaagaagaaaatcgacatcctgctg
aaggctgtgggagatacccctattatgaaaaccaagaaatgggctgtagagcgaacaaga
accatccaaggattcattgatttcatcagaaagttccttaagcttatggcctcagaacag
ttgtttatttatgtgaaccagtcctttgctccttccccagaccaagaagttggaactctg
tatgagtgtttcggcagtgatggcaaactggtcctgcattactgcaagtcgcaggcgtgg
ggatga

KEGG   Oryctolagus cuniculus (rabbit): 103347845
Entry
103347845         CDS       T03373                                 
Symbol
ATG12
Name
(RefSeq) autophagy related 12
  KO
K08336  ubiquitin-like protein ATG12
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04068  FoxO signaling pathway
ocu04136  Autophagy - other
ocu04140  Autophagy - animal
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103347845 (ATG12)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103347845 (ATG12)
   04136 Autophagy - other
    103347845 (ATG12)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103347845 (ATG12)
   04622 RIG-I-like receptor signaling pathway
    103347845 (ATG12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    103347845 (ATG12)
   04121 Ubiquitin system [BR:ocu04121]
    103347845 (ATG12)
   03029 Mitochondrial biogenesis [BR:ocu03029]
    103347845 (ATG12)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    103347845 (ATG12)
Ubiquitin system [BR:ocu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   103347845 (ATG12)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    103347845 (ATG12)
SSDB
Motif
Pfam: APG12 ATG8
Other DBs
NCBI-GeneID: 103347845
NCBI-ProteinID: XP_008253136
LinkDB
Position
3:complement(621952..633154)
AA seq 142 aa
MAEEPEAVLPLPPLAAAAAGGEGLPEGSPETATPEPPSSAAVSPGTEEPPGDTKKKIDIL
LKAVGDTPIMKTKKWAVERTRTIQGLIDFIRKFLKLMASEQLFIYVNQSFAPSPDQEVGT
LYECFGSDGKLVLHYCKSQAWG
NT seq 429 nt   +upstreamnt  +downstreamnt
atggcggaggagccggaggcagtgttgcctcttcctccgctcgctgctgctgctgctggc
ggcgaaggactcccggagggctccccggaaacagccacgccggagcccccttcttccgct
gccgtctccccggggacggaagagcctcctggcgacaccaagaagaaaatcgacatcctg
ctgaaggctgtgggagatacccctatcatgaaaaccaagaagtgggctgtagagcgaaca
agaaccatccaaggactcattgatttcatcagaaagttccttaagcttatggcctcagaa
cagttgtttatttatgtgaaccagtcctttgctccttccccagaccaagaagttggaact
ctgtatgagtgtttcggcagtgatggcaaactggtcctgcattactgcaagtcgcaggcg
tggggatga

DBGET integrated database retrieval system