KEGG   Oryctolagus cuniculus (rabbit): 100346881
Entry
100346881         CDS       T03373                                 
Symbol
CD27
Name
(RefSeq) CD27 molecule
  KO
K05144  tumor necrosis factor receptor superfamily member 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100346881 (CD27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100346881 (CD27)
   04090 CD molecules [BR:ocu04090]
    100346881 (CD27)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100346881 (CD27)
CD molecules [BR:ocu04090]
 Proteins
  100346881 (CD27)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 100346881
NCBI-ProteinID: XP_008257946
Ensembl: ENSOCUG00000008159
LinkDB
Position
8:32506907..32513654
AA seq 354 aa
MGQMLPQSRRQKQASRDQGAVGEQHSPACGKGEGGGGCCYKKKKTATAELQLPPKVGATG
RGVTAAAQEVQRGPPLRRGGRSAPCAQGAPWAGAMTWPPPCWLCILGALAGLSATSATKS
CPRRHYWAQGERCCRMCDPGTFLVKDCDEHGEAAQCEPCVPGVSFSPDHHSRHHCESCRH
CNSGLLIRNCTITSNGKCTCPSGWHCRDEECTECDPPPRPLVTAPPSQDPGPHPQPTHLP
YVKKWPAARTHRPAQTPADLRQLPAPVLPTHWPPQKTLCSSDCIRITVIFSGMFLVFTLG
GALFLHQQRKYGSNKGESAAVPAEPGPYSCPREEEGSAIPIQEAYRKPEPTSYP
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggtcaaatgcttccccagtctcggagacagaaacaagcaagcagagaccaaggcgct
gtgggagagcagcactcccctgcatgcggaaaaggggaagggggtggaggttgctgctac
aagaaaaaaaaaacagccacagcagagcttcaactgccgccaaaggtgggggcaactggg
agaggagttacagccgctgcccaggaggtgcaaaggggccccccgctccggagaggcggg
cggtcagcaccctgcgcacaaggagccccctgggcaggagccatgacatggccacctccc
tgctggctgtgcatcctgggggccctggcgggcctctcggctacctcagccaccaagagc
tgtccaaggaggcactactgggctcagggcgaacggtgctgccggatgtgtgacccaggg
acattcttggtgaaggactgtgatgagcacggagaggctgcccagtgtgaaccgtgtgtc
cccggggtctccttctctccggaccaccacagccggcaccactgtgagagctgtcggcac
tgcaactctggtcttctcatccgtaactgcaccatcaccagcaatggcaagtgcacctgc
cccagtggctggcactgcagggacgaagagtgtaccgagtgtgaccctcctccacgcccc
ttggtgaccgctcctccttctcaggacccaggcccacacccacagcccacccacttacct
tatgtcaaaaagtggccagcggccaggacacacaggcctgcgcagaccccggctgacttg
agacagctgcctgccccagttctccctacccactggccaccccagaagaccctgtgcagc
tccgactgcatccgcatcactgtgatcttctccggaatgtttcttgttttcaccttgggt
ggagccctgttcctccatcaacaaagaaaatatggatcaaacaaaggagaaagcgctgcg
gtgcccgcagagcctggtccttacagctgccccagggaggaggaaggcagcgccatcccc
atccaagaggcttaccggaagcccgaacctacttcctacccctga

DBGET integrated database retrieval system