KEGG   Oryctolagus cuniculus (rabbit): 100346964
Entry
100346964         CDS       T03373                                 
Symbol
CFLAR
Name
(RefSeq) CASP8 and FADD like apoptosis regulator
  KO
K04724  CASP8 and FADD-like apoptosis regulator
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04064  NF-kappa B signaling pathway
ocu04140  Autophagy - animal
ocu04210  Apoptosis
ocu04217  Necroptosis
ocu04668  TNF signaling pathway
ocu05142  Chagas disease
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100346964 (CFLAR)
   04668 TNF signaling pathway
    100346964 (CFLAR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100346964 (CFLAR)
  09143 Cell growth and death
   04210 Apoptosis
    100346964 (CFLAR)
   04217 Necroptosis
    100346964 (CFLAR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100346964 (CFLAR)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100346964 (CFLAR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100346964 (CFLAR)
Peptidases and inhibitors [BR:ocu01002]
 Cysteine peptidases
  Family C14: caspase family
   100346964 (CFLAR)
SSDB
Motif
Pfam: DED Peptidase_C14 DUF2433
Other DBs
NCBI-GeneID: 100346964
NCBI-ProteinID: XP_008257176
Ensembl: ENSOCUG00000011072
UniProt: G1T0J8
LinkDB
Position
7:141863432..141908804
AA seq 507 aa
MMSTAPWPPADWCRAFLLWFLDMTLCRMSAEVIHQVEEALDEDEKETLLFLCRDVTADAV
PPNVRELLDVLSEQGKLSVVDLAELLYRVRRFDLLKRILKMDKAAVEAHLHRHPHLVSDY
RVLMTEIGEDLEKSDVSSLIFLMRDYMGRGKIAKDKSFLDLVIELEKLNLVAPDQLDLLE
KCLKNIHRIDLKTKIQKYKQAAQGVERNYTNGFQASLPNLNLKDFSYNLLFQNGRNKDQR
LVERLGIPRAVKTSIQESAAFMPQHPPEERYRMQSKPLGICLIIDCTGNNVEALQNTFAS
LGYEVQPCSARRVDDVIRTLGQVACMPQHRDYDSFVCVLVSRGCSQSEFGVDENHSGFPL
HGIRRMFTGDSCPSLIGKPKLFFIQNYVVSEGRREDSSLLEVDGPAVNTVEAKAPQPRPS
MVHREADFFWSLCTADVSLLARSPGSRSMYLQFLSQKLGRERNRPLLDLHVELNSKVYDW
NSRAPAKEKYHVWLQHTLRKQLILSHQ
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgatgtctacagccccatggcctcctgctgactggtgcagagcttttctcctgtggttc
cttgacatgaccctgtgcaggatgtctgccgaagtcatccatcaggtggaagaggcgctt
gatgaagacgagaaggagacgctgcttttcctgtgccgggatgtcaccgcagacgccgtg
ccgccgaatgtcagggagctcctggatgttttaagtgagcaaggcaagctgtcggtggtg
gacttggctgagctgctctacagagtgagacggttcgacctgctcaagcggatcctgaag
atggacaaggcagccgtggaagcccacctgcacaggcaccctcaccttgtttccgactac
agggtgctgatgacagagatcggtgaagatttggagaaatctgatgtctcttcattgatt
ttcctcatgagagattatatgggcagaggcaagatagccaaggataagagtttcttggat
cttgtgattgagttggaaaaactaaatctggttgctccagatcaactggatttattggaa
aaatgcctaaagaacatccacagaatagacctgaagacaaaaatccagaagtacaagcag
gcagctcaaggagtggaaagaaattatacgaatggtttccaagcatctcttccaaacttg
aatctcaaagatttttcatataacttactgttccagaatgggagaaataaagaccaaaga
cttgtggaacgacttggcattccaagagcagtgaagacgtccatccaggaatcggcagcc
ttcatgcctcagcacccaccagaagagagatacaggatgcagagcaagcccctggggatc
tgcctgatcattgattgcactggcaataacgtagaggctcttcaaaacaccttcgcttcc
ctgggctatgaagtccagccctgctcggctcgccgtgtggatgacgtaatccggactctt
ggccaagtggcctgcatgccccagcaccgagactatgacagctttgtgtgtgtcctggtg
agccgaggatgctcccagagcgagttcggagtggacgagaatcactcggggttccctttg
catggcatcaggaggatgttcacgggggactcatgcccttctctcatagggaagccaaag
ctctttttcattcagaactatgtggtgtcagagggccggcgggaagacagcagccttctg
gaggtggacgggccggcagtgaacacagtggaagccaaggccccgcagccgagaccctcc
atggttcaccgggaagctgacttcttctggagcctgtgtactgcggacgtgtccctgctg
gctcggtcccctggctcacggtccatgtacctgcagttcctctcccagaaactgggccga
gaaagaaatcgcccactcctggatctccacgttgaactcaacagcaaagtgtatgattgg
aacagtcgcgctcctgctaaggagaagtaccacgtctggctgcagcacactctgagaaag
cagctcattctttctcaccaatga

DBGET integrated database retrieval system