KEGG   Oryctolagus cuniculus (rabbit): 100347053
Entry
100347053         CDS       T03373                                 
Symbol
WASL
Name
(RefSeq) Wiskott-Aldrich syndrome like
  KO
K23612  neural Wiskott-Aldrich syndrome protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04520  Adherens junction
ocu04810  Regulation of actin cytoskeleton
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100347053 (WASL)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100347053 (WASL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100347053 (WASL)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100347053 (WASL)
   05135 Yersinia infection
    100347053 (WASL)
   05100 Bacterial invasion of epithelial cells
    100347053 (WASL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100347053 (WASL)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100347053 (WASL)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    100347053 (WASL)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     100347053 (WASL)
SSDB
Motif
Pfam: WH1 PBD WH2 DUF4918 PQQ
Other DBs
NCBI-GeneID: 100347053
NCBI-ProteinID: XP_002712136
Ensembl: ENSOCUG00000008373
UniProt: A0A5F9CJS4
LinkDB
Position
7:20810819..20894293
AA seq 506 aa
MSSGQQQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWS
KKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVA
LNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGSQ
VNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDM
CGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRAGPPPPPPPPHSSG
PPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVGVPPPPPNRMYPPPPPALPSSAPTGP
PPPPPPPPLSGALAPPPPPPPPPPGPPPPPGLPSDGDHQVPAPAGSKAALLDQIREGAQL
KKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRS
KAIHSSDEDDEEDDEEDFEDDDEWED
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgagctccgggcagcagcagcagcagccgccgccgccgcggagggtcaccaacgtgggg
tccctgctgctcaccccgcaggagaacgagtccctgttcacgttcctcggcaagaaatgt
gtgacaatgtcttcagcagtggtacagttatatgctgcagatcggaactgtatgtggtca
aagaagtgcagtggggttgcatgtctagttaaggacaatccacagagatcttatttttta
agaatatttgacattaaggatgggaaactgttgtgggaacaagagttatataataacttt
gtatataatagtcctagaggatattttcatacctttgctggagatacttgtcaagttgct
cttaattttgccaatgaagaagaagcaaaaaaattccgaaaagcagttacagatttgttg
ggtcgacgacaaaggaaatctgaaaaaagacgagatcccccaaatggtcctaatctaccc
atggctacagttgacataaaaaacccagaaatcacaacaaatagattttatggttcacaa
gtcaacaatatttcccataccaaagaaaagaagaaaggaaaagctaaaaagaagagatta
accaaggcagatattggaacgccaagtaatttccagcacattggacatgttggttgggat
ccaaatacaggctttgatttgaataatttggatccagaattgaagaatctttttgatatg
tgtggaatctcagaggcacaacttaaagacagagaaacatcaaaagttatatatgacttt
attgaaaaaacgggaggtgtggaagctgttaaaaatgaactgcgaaggcaagcaccacca
cctccaccaccatcaagggcagggccacctcctcctccaccccctccgcatagctcaggc
cctccccctcctcctgccaggggaagaggtgcccctcctccaccaccttcaagagccccc
acagctgcacccccacctccgcctccttcgaggccaggtgtgggagtccctccaccaccg
ccaaataggatgtaccctcctccgcctccagcccttccctcctcagcacctacagggcct
ccaccaccaccaccacctccacctctgtcaggcgcactggcaccgcccccaccaccacca
cctcctccaccagggccaccacctccccctggcctgccttctgatggggaccatcaagtt
ccagctcctgcaggaagcaaagcagctcttttagatcaaattagagagggtgctcagcta
aagaaagtggaacagaacagtcgaccggtgtcctgctctggaagggatgcacttttagac
cagattcgacagggtattcagctgaagtctgtatctgatggccaagagtctacaccacca
acacctgcgcccacttcgggaattgtaggtgcattaatggaagtgatgcagaaaaggagc
aaagccattcattcctcagatgaggatgatgaagaagatgatgaagaagactttgaggac
gatgatgaatgggaagactga

DBGET integrated database retrieval system