KEGG   Oryctolagus cuniculus (rabbit): 100347202
Entry
100347202         CDS       T03373                                 
Symbol
NTN3
Name
(RefSeq) netrin 3
  KO
K06844  netrin 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100347202 (NTN3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N NTR
Other DBs
NCBI-GeneID: 100347202
NCBI-ProteinID: XP_017195073
LinkDB
Position
Un
AA seq 502 aa
PASLALLKSQDHGRSWAPLGFFSSHCGLDYGRPPVAARGPAGPGPEALCFPAPQVQPDGG
GLLAFSVQDGSPAGLDLDSSPVLQDWVTATDIRVVLTRPARPGDAGDVESTAPYSYSATE
LQVGGRCKCNGHASRCLLDAQGRLTCDCRHGTEGPDCGRCKPFYCDRPWQRATAREAHAC
LACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRDPGRALSDR
RACRACDCHPVGAAGKTCNQTTGQCPCKDGVAGLTCNRCAPGFQQSRSPVAPCVKTPVPG
PTQESRPVEPQDCDSHCRPARGSYRISLRKFCRKDYAVQVAVSARGEARGAWTRFPVAVL
AVFRSGEKRARRGSSALWVPALRSGDYIRARVCVSTCRPHGVKPPGSGECGPLPASPGAF
LGPLWEKTPEPVLVPGRLNALGGGVVLTEHQVEPAPQAHGAGAAARPRVPDPRAFACAPL
LGPARLFGSEAISQERPPGGPQ
NT seq 1509 nt   +upstreamnt  +downstreamnt
ccagcctccctggcccttctcaagtcgcaggaccacggccgcagctgggcccccctgggc
ttcttctcttcccactgtggcctggactacggccggccgcctgtcgccgcccgcggccct
gctggccctgggcctgaagccctgtgcttccctgcaccccaggtgcagcccgatgggggt
ggcctcctggccttcagcgtgcaggacggcagcccggcaggcctggacctggacagcagt
cccgtgctgcaggactgggtgacggctaccgacatccgagtggtgctcacaaggcctgcc
aggcccggggacgccggggacgtggagagcacggcgccctactcctactcggccaccgag
ctgcaagtgggcggccgctgcaagtgcaacgggcacgcctcgcgctgcctgctggacgcc
cagggccgcctgacctgtgactgccggcacggcaccgaggggcccgactgcggccgctgc
aagcccttctactgcgacaggccgtggcagcgggccacagcccgggaggcccacgcctgc
ctcgcttgttcctgcaacggtcacgcccgccgctgccgcttcaacatggagctgtaccgg
ctctcgggccgccgcagcgggggcgtctgcctgaactgccggcacaacaccgccggccgc
cactgccactactgccgggagggcttctaccgcgacccgggccgggccctgagcgaccgg
cgcgcctgcagagcctgtgactgtcacccagtcggtgccgctggcaaaacctgcaaccag
accacaggccagtgtccctgcaaggacggcgtcgcgggcctcacctgcaaccgctgtgcc
cccggcttccagcagagccgctctccggtggcaccctgcgtcaagactcctgtccccggc
cccacccaagagagccgccccgtggagccacaggactgcgactcgcactgcaggcctgcc
cgcggcagctaccgcatcagcctgcgcaagttctgccgcaaggactacgcggtgcaggtg
gcggtgagcgcgcgcggggaggcgcgcggcgcgtggacgcgcttcccagtggccgtgctc
gccgtgttccggagcggcgagaagcgagcgcggcgcgggagcagcgcgctgtgggtgccg
gctctgcgcagcggcgattacatccgggcccgggtctgcgtgtccacctgcagaccccat
ggagtgaagcccccaggctcaggggagtgtggacccctgcccgccagccctggcgccttc
ctcgggccgctgtgggagaagaccccggagcctgtgctggtgcccggccggctgaatgcc
cttggtgggggcgtggtcctcacggagcatcaggtggagcccgcgccccaggcccacggc
gctggcgctgccgctcggcctcgcgtccccgaccccagggcctttgcctgcgcccccctc
ctcggtcctgctcggctgttcggctcagaggccatctcccaggagaggccacccgggggt
cctcaataa

DBGET integrated database retrieval system