KEGG   Oryctolagus cuniculus (rabbit): 100347328
Entry
100347328         CDS       T03373                                 
Symbol
CCR4
Name
(RefSeq) C-C motif chemokine receptor 4
  KO
K04179  C-C chemokine receptor type 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100347328 (CCR4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100347328 (CCR4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100347328 (CCR4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100347328 (CCR4)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100347328 (CCR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100347328 (CCR4)
   04050 Cytokine receptors [BR:ocu04050]
    100347328 (CCR4)
   04090 CD molecules [BR:ocu04090]
    100347328 (CCR4)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    100347328 (CCR4)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CC Chemokine
   100347328 (CCR4)
CD molecules [BR:ocu04090]
 Proteins
  100347328 (CCR4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100347328
NCBI-ProteinID: XP_002716297
Ensembl: ENSOCUG00000024244
LinkDB
Position
14:19909255..19937979
AA seq 360 aa
MNPTDLTDTTVDESIYSNYYAYESMPKPCTKEGIKAFGKLFLPPLYSLVFLFGLLGNSVV
VLVLFKYKRLRSMTDVYLLNLAVSDLLFVLSLPFWGYYAADQWVFGLGLCKFVSWMYLVG
FYSGIFFIMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAIFASLPGLLFSTCYT
ERNHTYCRARFSVNSTTWKVLSSLETNILGLVVPLAVMLFCYSTIVRALQRCKSEKRSKA
VKMVFAVVVLFLGFWAPYNVVLFLETLVELELLQDCTFERQLDYAVQATETLAFVHCCLN
PVIYFFLGEKFRKYIVQLFKTCRGPLALCQPCGVLQLYPADTPSSSHTQSTVDHDLYDAL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaaccccacggatctcacagacaccaccgtggacgagagcatttatagcaattactat
gcgtacgagagtatgcccaagccttgcaccaaagagggcatcaaggctttcgggaagctc
ttcctgccccccctgtactccttggtcttcctctttggcctgctggggaactccgtggtg
gtcctggtgctgttcaagtacaagcggctcaggtccatgaccgacgtgtacctgctcaac
cttgccgtctccgacctgctcttcgtgctctccctcccgttctggggctactacgccgcg
gaccagtgggtgttcgggctggggctgtgcaagttcgtgtcctggatgtacctggtgggc
ttctacagcggcatcttcttcatcatgctcatgagcatcgacaggtacctggccatcgtg
cacgccgtgttctccttgcgagccaggaccttgacctacggggtcatcaccagcttggct
acctggtcagtggccatcttcgcctcccttcccggcctcctgttcagcacctgctacacc
gagcgcaaccacacctactgcagggccaggttctcggtgaactccaccacgtggaaggtg
ctgagctccctggagaccaacatcctggggctggtggtgccgctggctgtcatgctgttc
tgctactccacgatcgtcagggccttgcagcgctgcaagagcgagaagaggagcaaggcc
gtgaagatggtcttcgccgtggtggtcctcttcctgggcttctgggcgccctacaacgtg
gtgctcttcctggagacgctggtggagctggagctgcttcaggactgcaccttcgagagg
cagctggactacgccgtccaggccacagagacgctggccttcgtccactgctgcctgaac
cccgtcatctacttcttcctgggggagaagtttcgcaagtacatcgtgcagctcttcaag
acctgccgcggccccctggcgctctgccagccctgcggggtcctgcagctgtaccccgcc
gacaccccgagctcctcgcacacgcagtccaccgtggaccacgacctctacgacgcgctg
tag

DBGET integrated database retrieval system