KEGG   Oryctolagus cuniculus (rabbit): 100347345
Entry
100347345         CDS       T03373                                 
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu01524  Platinum drug resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04114  Oocyte meiosis
ocu04140  Autophagy - animal
ocu04148  Efferocytosis
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04218  Cellular senescence
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04350  TGF-beta signaling pathway
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04371  Apelin signaling pathway
ocu04380  Osteoclast differentiation
ocu04510  Focal adhesion
ocu04520  Adherens junction
ocu04540  Gap junction
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04611  Platelet activation
ocu04613  Neutrophil extracellular trap formation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04668  TNF signaling pathway
ocu04713  Circadian entrainment
ocu04720  Long-term potentiation
ocu04722  Neurotrophin signaling pathway
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04726  Serotonergic synapse
ocu04730  Long-term depression
ocu04810  Regulation of actin cytoskeleton
ocu04910  Insulin signaling pathway
ocu04912  GnRH signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04917  Prolactin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04929  GnRH secretion
ocu04930  Type II diabetes mellitus
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04960  Aldosterone-regulated sodium reabsorption
ocu05010  Alzheimer disease
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05034  Alcoholism
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05207  Chemical carcinogenesis - receptor activation
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05216  Thyroid cancer
ocu05218  Melanoma
ocu05219  Bladder cancer
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100347345
   04012 ErbB signaling pathway
    100347345
   04014 Ras signaling pathway
    100347345
   04015 Rap1 signaling pathway
    100347345
   04350 TGF-beta signaling pathway
    100347345
   04370 VEGF signaling pathway
    100347345
   04371 Apelin signaling pathway
    100347345
   04668 TNF signaling pathway
    100347345
   04066 HIF-1 signaling pathway
    100347345
   04068 FoxO signaling pathway
    100347345
   04072 Phospholipase D signaling pathway
    100347345
   04071 Sphingolipid signaling pathway
    100347345
   04024 cAMP signaling pathway
    100347345
   04022 cGMP-PKG signaling pathway
    100347345
   04151 PI3K-Akt signaling pathway
    100347345
   04150 mTOR signaling pathway
    100347345
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100347345
   04148 Efferocytosis
    100347345
  09143 Cell growth and death
   04114 Oocyte meiosis
    100347345
   04210 Apoptosis
    100347345
   04218 Cellular senescence
    100347345
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100347345
   04520 Adherens junction
    100347345
   04540 Gap junction
    100347345
   04550 Signaling pathways regulating pluripotency of stem cells
    100347345
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100347345
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100347345
   04613 Neutrophil extracellular trap formation
    100347345
   04620 Toll-like receptor signaling pathway
    100347345
   04621 NOD-like receptor signaling pathway
    100347345
   04625 C-type lectin receptor signaling pathway
    100347345
   04650 Natural killer cell mediated cytotoxicity
    100347345
   04660 T cell receptor signaling pathway
    100347345
   04658 Th1 and Th2 cell differentiation
    100347345
   04659 Th17 cell differentiation
    100347345
   04657 IL-17 signaling pathway
    100347345
   04662 B cell receptor signaling pathway
    100347345
   04664 Fc epsilon RI signaling pathway
    100347345
   04666 Fc gamma R-mediated phagocytosis
    100347345
   04062 Chemokine signaling pathway
    100347345
  09152 Endocrine system
   04910 Insulin signaling pathway
    100347345
   04929 GnRH secretion
    100347345
   04912 GnRH signaling pathway
    100347345
   04915 Estrogen signaling pathway
    100347345
   04914 Progesterone-mediated oocyte maturation
    100347345
   04917 Prolactin signaling pathway
    100347345
   04921 Oxytocin signaling pathway
    100347345
   04926 Relaxin signaling pathway
    100347345
   04935 Growth hormone synthesis, secretion and action
    100347345
   04919 Thyroid hormone signaling pathway
    100347345
   04928 Parathyroid hormone synthesis, secretion and action
    100347345
   04916 Melanogenesis
    100347345
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100347345
   04270 Vascular smooth muscle contraction
    100347345
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100347345
  09156 Nervous system
   04724 Glutamatergic synapse
    100347345
   04725 Cholinergic synapse
    100347345
   04726 Serotonergic synapse
    100347345
   04720 Long-term potentiation
    100347345
   04730 Long-term depression
    100347345
   04723 Retrograde endocannabinoid signaling
    100347345
   04722 Neurotrophin signaling pathway
    100347345
  09158 Development and regeneration
   04360 Axon guidance
    100347345
   04380 Osteoclast differentiation
    100347345
  09159 Environmental adaptation
   04713 Circadian entrainment
    100347345
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100347345
   05206 MicroRNAs in cancer
    100347345
   05205 Proteoglycans in cancer
    100347345
   05207 Chemical carcinogenesis - receptor activation
    100347345
   05208 Chemical carcinogenesis - reactive oxygen species
    100347345
   05203 Viral carcinogenesis
    100347345
   05230 Central carbon metabolism in cancer
    100347345
   05231 Choline metabolism in cancer
    100347345
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100347345
  09162 Cancer: specific types
   05210 Colorectal cancer
    100347345
   05212 Pancreatic cancer
    100347345
   05225 Hepatocellular carcinoma
    100347345
   05226 Gastric cancer
    100347345
   05214 Glioma
    100347345
   05216 Thyroid cancer
    100347345
   05221 Acute myeloid leukemia
    100347345
   05220 Chronic myeloid leukemia
    100347345
   05218 Melanoma
    100347345
   05211 Renal cell carcinoma
    100347345
   05219 Bladder cancer
    100347345
   05215 Prostate cancer
    100347345
   05213 Endometrial cancer
    100347345
   05224 Breast cancer
    100347345
   05223 Non-small cell lung cancer
    100347345
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100347345
   05170 Human immunodeficiency virus 1 infection
    100347345
   05161 Hepatitis B
    100347345
   05160 Hepatitis C
    100347345
   05171 Coronavirus disease - COVID-19
    100347345
   05164 Influenza A
    100347345
   05163 Human cytomegalovirus infection
    100347345
   05167 Kaposi sarcoma-associated herpesvirus infection
    100347345
   05165 Human papillomavirus infection
    100347345
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100347345
   05135 Yersinia infection
    100347345
   05133 Pertussis
    100347345
   05152 Tuberculosis
    100347345
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100347345
   05140 Leishmaniasis
    100347345
   05142 Chagas disease
    100347345
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100347345
   05020 Prion disease
    100347345
   05022 Pathways of neurodegeneration - multiple diseases
    100347345
  09165 Substance dependence
   05034 Alcoholism
    100347345
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100347345
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100347345
   04933 AGE-RAGE signaling pathway in diabetic complications
    100347345
   04934 Cushing syndrome
    100347345
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100347345
   01524 Platinum drug resistance
    100347345
   01522 Endocrine resistance
    100347345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100347345
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100347345
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100347345
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100347345
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100347345
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100347345
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100347345
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 100347345
NCBI-ProteinID: XP_051682699
LinkDB
Position
21:complement(6079552..6183400)
AA seq 360 aa
MAAAAAAGTGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcacgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaacctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtggctatcaagaaaatcagtccttttgag
caccagacctactgccagcgaaccctgagggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgacattattcgagccccaaccattgagcagatgaaagat
gtatacatagtccaggacctcatggaaacagatctttacaagctcttgaagacacagcac
ctcagcaacgaccatatctgctattttctctaccagatcctcagagggttaaaatacatc
cattcagccaacgttctgcaccgtgacctcaagccttccaacctgctgctcaacaccacc
tgtgatctcaagatctgtgacttcggcctggcccgcgttgcggatccggaccatgatcac
acagggttcctgacagagtatgtagccacgcgttggtacagggctccagaaattatgctg
aattccaagggctacaccaagtccatcgacatctggtctgtaggctgcatcctggcggag
atgctctccaacagacccatcttcccggggaagcactacctggaccagctgaaccacatt
ctgggtattcttggatccccttcacaagaagacctgaattgtataataaacttaaaagcc
agaaactatttgctttctcttccacacaaaaacaaggtgccatggaacaggctgtttcca
aatgctgactccaaagctctggacttgctggacaagatgttgactttcaaccctcacaag
aggatcgaagtagagcaggccctggcccacccctacctggagcagtattacgacccgagt
gacgagcccatcgccgaagctccattcaagttcgacatggaattggatgacttgcctaag
gaaaagctcaaagaactcatttttgaagagactgcgagattccagccaggatacagatct
taa

DBGET integrated database retrieval system