KEGG   Oryctolagus cuniculus (rabbit): 100347487
Entry
100347487         CDS       T03373                                 
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04062  Chemokine signaling pathway
ocu04068  FoxO signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04137  Mitophagy - animal
ocu04140  Autophagy - animal
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04218  Cellular senescence
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04371  Apelin signaling pathway
ocu04540  Gap junction
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04625  C-type lectin receptor signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04714  Thermogenesis
ocu04720  Long-term potentiation
ocu04722  Neurotrophin signaling pathway
ocu04725  Cholinergic synapse
ocu04726  Serotonergic synapse
ocu04730  Long-term depression
ocu04810  Regulation of actin cytoskeleton
ocu04910  Insulin signaling pathway
ocu04912  GnRH signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04917  Prolactin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04929  GnRH secretion
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu04960  Aldosterone-regulated sodium reabsorption
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05034  Alcoholism
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05207  Chemical carcinogenesis - receptor activation
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05216  Thyroid cancer
ocu05218  Melanoma
ocu05219  Bladder cancer
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100347487
   04012 ErbB signaling pathway
    100347487
   04014 Ras signaling pathway
    100347487
   04015 Rap1 signaling pathway
    100347487
   04370 VEGF signaling pathway
    100347487
   04371 Apelin signaling pathway
    100347487
   04068 FoxO signaling pathway
    100347487
   04072 Phospholipase D signaling pathway
    100347487
   04071 Sphingolipid signaling pathway
    100347487
   04151 PI3K-Akt signaling pathway
    100347487
   04150 mTOR signaling pathway
    100347487
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100347487
   04137 Mitophagy - animal
    100347487
  09143 Cell growth and death
   04210 Apoptosis
    100347487
   04218 Cellular senescence
    100347487
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100347487
   04550 Signaling pathways regulating pluripotency of stem cells
    100347487
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100347487
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100347487
   04650 Natural killer cell mediated cytotoxicity
    100347487
   04660 T cell receptor signaling pathway
    100347487
   04662 B cell receptor signaling pathway
    100347487
   04664 Fc epsilon RI signaling pathway
    100347487
   04062 Chemokine signaling pathway
    100347487
  09152 Endocrine system
   04910 Insulin signaling pathway
    100347487
   04929 GnRH secretion
    100347487
   04912 GnRH signaling pathway
    100347487
   04915 Estrogen signaling pathway
    100347487
   04914 Progesterone-mediated oocyte maturation
    100347487
   04917 Prolactin signaling pathway
    100347487
   04921 Oxytocin signaling pathway
    100347487
   04926 Relaxin signaling pathway
    100347487
   04935 Growth hormone synthesis, secretion and action
    100347487
   04919 Thyroid hormone signaling pathway
    100347487
   04916 Melanogenesis
    100347487
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100347487
  09156 Nervous system
   04725 Cholinergic synapse
    100347487
   04726 Serotonergic synapse
    100347487
   04720 Long-term potentiation
    100347487
   04730 Long-term depression
    100347487
   04722 Neurotrophin signaling pathway
    100347487
  09158 Development and regeneration
   04360 Axon guidance
    100347487
  09149 Aging
   04211 Longevity regulating pathway
    100347487
   04213 Longevity regulating pathway - multiple species
    100347487
  09159 Environmental adaptation
   04714 Thermogenesis
    100347487
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100347487
   05206 MicroRNAs in cancer
    100347487
   05205 Proteoglycans in cancer
    100347487
   05207 Chemical carcinogenesis - receptor activation
    100347487
   05208 Chemical carcinogenesis - reactive oxygen species
    100347487
   05203 Viral carcinogenesis
    100347487
   05230 Central carbon metabolism in cancer
    100347487
   05231 Choline metabolism in cancer
    100347487
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100347487
  09162 Cancer: specific types
   05210 Colorectal cancer
    100347487
   05212 Pancreatic cancer
    100347487
   05225 Hepatocellular carcinoma
    100347487
   05226 Gastric cancer
    100347487
   05214 Glioma
    100347487
   05216 Thyroid cancer
    100347487
   05221 Acute myeloid leukemia
    100347487
   05220 Chronic myeloid leukemia
    100347487
   05218 Melanoma
    100347487
   05211 Renal cell carcinoma
    100347487
   05219 Bladder cancer
    100347487
   05215 Prostate cancer
    100347487
   05213 Endometrial cancer
    100347487
   05224 Breast cancer
    100347487
   05223 Non-small cell lung cancer
    100347487
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100347487
   05170 Human immunodeficiency virus 1 infection
    100347487
   05161 Hepatitis B
    100347487
   05160 Hepatitis C
    100347487
   05163 Human cytomegalovirus infection
    100347487
   05167 Kaposi sarcoma-associated herpesvirus infection
    100347487
   05165 Human papillomavirus infection
    100347487
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100347487
   05022 Pathways of neurodegeneration - multiple diseases
    100347487
  09165 Substance dependence
   05034 Alcoholism
    100347487
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100347487
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100347487
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100347487
   01522 Endocrine resistance
    100347487
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100347487
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ocu04031]
    100347487
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100347487
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100347487
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase MeaB FeoB_N ATP_bind_1 Septin NPR1_interact G1_gp67_C DUF7153
Other DBs
NCBI-GeneID: 100347487
NCBI-ProteinID: XP_051706297
Ensembl: ENSOCUG00000012106
LinkDB
Position
8:complement(96713956..96762247)
AA seq 216 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKK
SKTKCIIMLFTFLIRRKTVYLLSTEGQIHSEDQKEP
NT seq 651 nt   +upstreamnt  +downstreamnt
atgaccgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgaccctacaattgaggattcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgagaactggggagggctttctttgt
gtgtttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagttaaagactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaagctcaggacttagcaagaagttatggaattcct
tttattgaaacatctgcaaagacaagacagggtgttgacgatgccttctatacattagtt
cgagaaattcgaaaacataaagaaaagatgagcaaagatggtaaaaagaagaaaaagaag
tcaaagacaaagtgtataattatgctgtttactttccttatcagaagaaagactgtttac
ctgctgtcaacggaaggccagatccattcagaggatcaaaaggagccctga

DBGET integrated database retrieval system