KEGG   Oryctolagus cuniculus (rabbit): 100347492
Entry
100347492         CDS       T03373                                 
Symbol
IL31RA
Name
(RefSeq) interleukin 31 receptor A
  KO
K22630  interleukin 31 receptor subunit alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100347492 (IL31RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100347492 (IL31RA)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL6/12 receptor family
   100347492 (IL31RA)
SSDB
Motif
Pfam: fn3 IL2RB_N1 IL6Ra-bind EpoR_lig-bind IL4Ra_N fn3_2
Other DBs
NCBI-GeneID: 100347492
NCBI-ProteinID: XP_017200213
Ensembl: ENSOCUG00000007830
LinkDB
Position
11:71828930..71879561
AA seq 724 aa
MMWTWALWMLPFLCKCSLAALPAKPENISCVYYYMKNLTCTWSPEREINHTNYTVTRMYT
YAKKKETCRTNSSASENRPSCSFFPPKVTNTDYFTVEVEAENADGIVKSYVTEWHTDTIV
KTEPPEILSVKPVLGVKRMLQVKWKAPAQAPEPPNFLYRLRFWAINSTSRKRLQFPSNYV
DYAYNLTGLQASTEYVVNLQCMVRESKFWSDLSREERGVTEAEAPYGLELWRVLRPAEAD
GKRPVRLLWKKARGAPVLEETLFYNIQYTPENNPNLTETENTTDQQFKLRLGGETYRVTV
RSYNSLGPSPEAKLRIPAIREKPFQCIEGMQARLAQGLLVVEWQSCDLEVDAWMVEWVPD
LDSELSALSWESVSGAKKWTIQQDKLKPLWCYNISVYPVLQDEVGEPYSIQAYAKEGIPS
KGPVTKVENIGLKTARITWKEIPMRERNGFINNYTIFYQAEDGREFSKTVNSSILQYDLE
SLTRKTSYAVRVMASTSAGGHNGTTINFKTLSINVLEIVLITSLVGGSLLLLFILTVAYG
LKKPNKLSHLCWPDVPNPAESSLATWRGHNFKGERNLKELDDAGNTEDRILKSCSAPSDL
IDKLVVNFENFLEDVSTGEAGKGWESIWGGEKNEYVTPPSRRDCPPGRSVEGALPLTEPL
PAGLTQHLLPTTRGGGCSEAPGQPLPSGPGLGEDDAPTLYLKNSVTTREFLVSEVLPDHT
ERQA
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgatgtggacctgggcactgtggatgctcccttttctctgcaaatgcagcctggcagct
ctgccagctaagcctgagaacatttcttgtgtctactactatatgaaaaatttaacttgc
acatggagtccagagagagaaatcaaccacaccaactacacagttacgagaatgtacaca
tatgcaaagaaaaaggagacttgcaggaccaacagttctgcaagtgaaaatcggccttcg
tgttctttctttcctccaaaagtgacaaatacagattattttactgttgaagtggaagca
gaaaatgcagacggtatagtgaaatcttatgtgacagagtggcacacagacaccatagtg
aaaactgaaccacctgagattttgagtgtgaaaccagttttgggcgtcaaacgaatgctt
caagtaaaatggaaagcacctgcacaggctcccgaaccacccaatttcttatacagactt
cgcttctgggccatcaatagtacaagtcggaagagactgcaattccccagcaactatgta
gactatgcctacaacctcacaggactgcaggcgtctacggagtatgtcgtgaatctgcag
tgtatggtcagagagtcaaagttctggagcgacttgagccgagaagaaaggggagtaacg
gaggcggaagctccatacggcctggaactgtggcgggtcctgagaccagctgaggcagat
ggaaaaaggccagtgcggctgctgtggaagaaagcaagaggagccccagtcctggaggaa
acacttttctacaacattcagtacactccggaaaacaatcctaacctcacagagacagag
aacaccacggaccagcagttcaaactgcgtctgggcggcgagacctatcgggtgactgtg
aggtcttacaattctcttgggccttccccagaggccaagctgaggatcccagctatccgt
gaaaagccatttcagtgcatcgagggcatgcaggccaggctggctcagggcctgctggtg
gtggagtggcagagctgcgacctggaggtggacgcctggatggttgagtgggtcccagat
ttggactcagaactttctgccttgtcctgggaatctgtgtctggggccaagaagtggaca
atccagcaagataagttaaaacctttgtggtgctataacatctctgtgtatccagtgttg
caagacgaagtgggcgagccatattctatccaggcttatgccaaagaaggcattccatcg
aaaggacccgtgaccaaggtggagaacattggtctgaagacagccagaatcacatggaaa
gaaattcccatgagggagagaaatggtttcatcaacaactacaccatattttaccaagct
gaagatggaagagaattctccaagaccgtcaactcaagcattcttcagtatgacttggag
tccttgacacggaagacttcctatgctgtccgggttatggccagtaccagtgctggggga
cacaatgggaccacaataaacttcaagacgttgtcgattaatgtccttgagattgtcctt
ataacgtctctggttggaggaagcctcctccttctcttcatcctgactgtggcctacggt
ctcaagaagcccaacaaactgtctcacttgtgttggcccgatgttcccaaccctgctgaa
agtagtttagctacgtggcgtggacataatttcaagggtgagcgaaatctgaaggagttg
gatgacgctgggaacacagaagacaggatcctaaaatcatgttctgcccccagcgacctg
atcgacaaattggtggtgaactttgagaattttctggaagatgtttccacaggggaagcc
ggaaagggttgggaaagcatttggggaggggaaaagaacgaatatgtgacccccccctcc
aggcgtgactgccccccagggaggagtgtcgagggggccctgcctctgactgagcctctt
cctgctgggctgacccagcacctgcttcccacaacgcggggagggggctgctccgaggcc
ccagggcagcccctgccctccggcccgggtctcggggaggacgacgcgccgactctgtat
ttgaaaaattcagtgacaaccagggaatttctcgtgtctgaagtccttccggaccacacc
gagagacaagcataa

DBGET integrated database retrieval system