KEGG   Oryctolagus cuniculus (rabbit): 100347510
Entry
100347510         CDS       T03373                                 
Symbol
BOC
Name
(RefSeq) BOC cell adhesion associated, oncogene regulated
  KO
K20020  brother of CDO
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04340  Hedgehog signaling pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100347510 (BOC)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100347510 (BOC)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 fn3 ig ISET-FN3_linker V-set C2-set_2 Pur_ac_phosph_N Ig_5 Ig_4 C1-set Izumo-Ig Y_Y_Y
Other DBs
NCBI-GeneID: 100347510
NCBI-ProteinID: XP_002716745
Ensembl: ENSOCUG00000010827
LinkDB
Position
14:complement(105924697..106002237)
AA seq 1110 aa
MLHGMMMARRGKRSEVTLACLLLATAGCFADLDEVPQVTVQPASTVQKLGGTVILGCVVE
PPWMNITWRLNGKELNGSDDALGVLLTRGTLVIPALSNHTVGRYQCVARMPAGAVASVPA
TVTLANLQDFKLDVQHVIEVDEGNTAVIACHLPESHPKAQVRYSVKQEWLEASRDNYLIM
PSGNLQIVNASQEDEGMYKCAAYNPVTQEVKTSGSSDRLRVRRSTAEAARIIYPPEAQTI
IVTKGQSLILECVAGGIPPPRVTWAKDGTSVTGYNKTRFLLSNLLIDPTSEEDSGTYRCM
ADNGVGAPGAAVILYNVQVFEPPEVSVELSQLVIPWGQSAKLTCEVRGNPPPSVLWLRNA
VPLAASQRLRLSRGALRVVSVGPEDEGVYQCMAENEVGSAHAVVQLRTARPGTTLQPWRD
ARLATATPAAPPFRPGSPDQMLGARPGLARPPTSVQPASPQCPGEKGQVAPAEAPIILSS
PRTSKTDSYELVWRPRHEGGSRAPILYYVVKHRKVTNSSDDWTIAGIPAGQHRLTLTRLD
PGSLYEVEMAAYNCAGEGQTAMVTFRTGRRPKPEIMASKEQQIQRDDPGASPQSSSQPDH
GRLSPPEAPDRPTISMASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKVGDWILATSAIP
PSRLSVEITGLEKGTSYKFRVRALNMLGESEPSAPSRPYVVSGYSGRVYERPVAGPYITF
TDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDRYWHSISHL
QPETSYDIKMQCFNAGGESEFSNVMICETKARKSSGQPGRLPPPTMAPPQPPPPETIERP
MGTGAMVARSSDLPYLIVGVVLGSIVLIIVTFIPFCLWRAWSKQKHTTDLAFPRSALLAS
SCQYTMVPLGGLPGHRADAQPYGSGLSGQARGGRVHVSRGCPAGPAAYPGTKPQQHCPGE
LQQQDDTNSLLSQTLLGTVYDSQSHQLARGPTPHPDEGAFLYTLPDDSAHQLLQPHLQEQ
PLATGRSHVRSAPDGPGLEAPWDPAFHSGTPCCLGLVPVEEVDSPDICQVGGGDWCPQHP
TGSYLGQEPGMRRSASPTVHVSFETPPPTV
NT seq 3333 nt   +upstreamnt  +downstreamnt
atgctgcatgggatgatgatggcgcggagaggaaagaggtctgaggtcacactcgcctgc
ctcctcctggccacagcaggctgctttgcggacttggatgaggtcccccaggtcaccgtc
cagcctgcgtctactgtccagaagctcggcggaactgtgattctgggctgcgtggtggag
cccccgtggatgaacataacctggcgcctgaacgggaaggagctgaatggctccgacgac
gctctgggcgtcctcctcacccgcgggaccctcgtcatccctgccctcagcaaccacacc
gtggggcggtaccagtgtgtggcccggatgcccgcgggggctgtggccagcgtgccagcc
acagtgacactagccaatctccaggacttcaagttagatgtgcagcacgtgattgaagtg
gacgaggggaacaccgccgtcatcgcctgccaccttcccgagagccacccgaaagcccag
gtccggtatagcgtcaaacaggagtggctggaggcctccagagataactacctgatcatg
ccgtcagggaacctgcagattgtaaacgccagccaggaggacgaaggcatgtacaagtgc
gccgcctacaacccagtgacccaagaagtgaaaacctctggctccagcgataggctgcgc
gtgcgccgctccactgccgaggccgcccgcatcatctaccccccggaggcccagaccatc
atcgtcaccaaaggccagagcctcatcctggaatgtgtggccggcgggatccccccgccc
cgcgtcacctgggccaaggatgggaccagtgtcactggctacaacaagacacgcttcctc
ctgagcaacctgctcattgaccccacgagtgaggaggactcgggcacctaccgctgcatg
gctgacaacggggtcggcgcgcctggcgccgccgtcatcctctacaatgtccaggtgttc
gaaccccccgaggtcagcgtggagctgtcccagctggtcatcccgtggggccagagcgcc
aagctcacctgtgaggtgcgtgggaacccaccgccttctgtgctgtggctgaggaacgcc
gtgcccctggccgccagccagcgcctgcggctgtcccgtggggccttgcgtgtggtgagc
gtggggcctgaggacgaaggcgtctaccagtgcatggccgagaatgaagtcgggagcgcc
cacgccgtggtccagctgaggactgccaggccaggcacaaccctgcaaccctggcgggat
gccaggctggccactgccaccccggctgcgccacccttcagacccggcagccctgaccag
atgctgggggcgcggccggggctcgccaggccccctacatcggtgcagcctgcttcccct
cagtgcccaggagagaaggggcaggtggctcctgctgaggcccccatcatcctcagctcc
ccccgcacctccaagacagactcctacgagctggtgtggcggcctcggcacgagggcggc
agccgggcaccgatcctctactacgtggtgaaacaccgcaaggtcacaaactcctctgat
gactggacgatcgccggcatccccgccggccagcaccgcctgaccctcaccaggcttgac
ccggggagcctgtatgaagtggagatggcagcgtacaactgtgcgggcgagggccagaca
gccatggtcaccttccgaactggacggcggcccaaacccgagatcatggccagcaaggag
cagcagatccagagagatgaccctggcgccagcccccagagcagcagccagccggaccac
ggccgcctctcgcccccagaagctccagacaggcctactatctccatggcctccgagacc
tccgtgtacgtgacctggattccccgtgggaacggtgggttcccgatccagtccttccgt
gtggagtacaagaagctaaagaaagtgggagactggattctggccaccagtgccatccct
ccctcccggctctctgtggagatcacaggcctggagaaaggcacctcttacaagttccga
gtccgggcactgaacatgctgggggagagtgagcccagtgccccctcccggccctacgtg
gtgtctggctacagcgggcgtgtgtatgagcggcctgtggcaggcccgtacatcaccttc
acagatgctgtcaatgagaccaccatcatgctcaagtggatgtatattccagcaagtaac
aacaacaccccaatccatggcttttacatttattatcggcccaccgacagtgacaatgac
agtgactacaagaaggacatggtggaaggggacaggtactggcactctatcagccacctg
cagccagagacctcctatgacattaagatgcagtgcttcaacgcaggaggcgagagcgag
ttcagcaacgtgatgatctgcgagaccaaagcccgcaagtcttcgggccagcccggtcga
ctcccgcccccaacaatggccccaccgcagcctccaccccctgaaaccatagagcggccg
atgggcaccggggccatggtggcccgctccagcgacctgccctacctgatcgtcggcgtc
gtcctgggctccatcgtcctcatcatcgtcaccttcatccccttctgcttgtggagggcc
tggtctaagcagaaacataccacagacctggctttccctcgaagtgccctgctggcctcc
tcctgccagtacaccatggtgccgctcggaggactcccgggccaccgagccgacgctcag
ccctatggcagtggcctcagtggacaggcccgtggcggcagggtccacgtgagcaggggc
tgccccgccgggcccgcggcctaccccggcacgaagcctcagcagcactgcccaggggag
cttcagcagcaagatgacaccaacagcctgctgagccagacccttcttggcactgtgtac
gactcccaaagccaccagctggccaggggccccacgcctcacccagacgagggcgcattc
ttatacacactgcctgatgactcagctcaccagctgctgcagccccacctccaggaacag
cctcttgccacgggccggtcacacgtgaggagtgcacccgacggtcctgggctggaggcg
ccgtgggaccctgcatttcactcagggaccccgtgctgtttgggcctggtacccgtggaa
gaggtggacagtcctgacatctgccaagtgggtggaggagactggtgtccccagcacccc
acggggtcctacctaggacaggaacctgggatgcggcgctccgccagcccaacggtgcat
gtgtcttttgaaacgccgcctcctacagtttag

DBGET integrated database retrieval system