KEGG   Oryctolagus cuniculus (rabbit): 100347525
Entry
100347525         CDS       T03373                                 
Symbol
DHX58
Name
(RefSeq) DExH-box helicase 58
  KO
K12649  ATP-dependent RNA helicase DHX58 [EC:3.6.4.13]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100347525 (DHX58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ocu04054]
    100347525 (DHX58)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100347525 (DHX58)
Pattern recognition receptors [BR:ocu04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   100347525 (DHX58)
SSDB
Motif
Pfam: RIG-I_C-RD RIG-I_C ResIII Helicase_C DEAD SWI2_SNF2 AAA_19
Other DBs
NCBI-GeneID: 100347525
NCBI-ProteinID: XP_002719437
Ensembl: ENSOCUG00000013278
LinkDB
Position
19:complement(42938166..42946286)
AA seq 678 aa
MELRPYQWEVIVPALEGKNIIIWLPTGTGKTRAAAYVAKRHLETVPGAKVVVLVNRVHLV
TQHSEEFGRMLDGHWTMTTLRGDMGPRAGFGHLARGHDLLICTAELLQMALTSTEEEEHV
ELTAFTLLVVDECHHTHKDTVYNVILSRYLELKVHRTQPLPQVLGLTASPGTGGASKLDG
AIDHILQLCANLDTWRIMSPERYRSQLLQLNQKRCKQYDLCHRRSQDPFGDLVRKIMDQI
HDHMEMEELSRDFGTQTYEQQVVELSQAAAKAGLQEQRVHALHLRRYNDALLIHDTVRAV
DALDTLQDFYDRERTTKARILHAERWLLALFDEHKNTLARLATQSPENPKLEMLENILRT
QFRSPDSPRGIIFTRTRQSARSLLLWVQQQPGLQTVDIRPQMLIGAGSSSQSTHMTQRDQ
EEVIRRFRAGMLNLLVATSVVEEGMDIPHCNVVVRYGLLTNEISMVQARGRARADQSVYS
FVATEGSRELRRELTNEMLEALMEQAVGAVQKMDQAEYQAKIRQLQLAALVQRAARADQK
EQVRQQFPAEHVRLLCVNCMEAVGHGSDLRKVEGAHHVNVNPNFSIYYAVSRDPVPINRE
FKDWKPGGTIRCRNCGESWGLQMIYKSVKLPVLKVRSMLLETPRGRIQAKKWSRVPFPVA
DFDFLQHCTQSLSDLSLD
NT seq 2037 nt   +upstreamnt  +downstreamnt
atggagctacgcccctaccagtgggaggtgatcgtgcctgccctggaaggcaagaatatc
atcatctggctgcccacgggcactgggaagacccgggcggccgcttacgtggccaagcgg
cacctggagaccgtgcctggagccaaggtggtggtgctggtcaacagggtgcacctggtg
acccagcacagcgaggagttcggccgcatgctggatggacactggaccatgacaaccctg
aggggggacatgggcccccgcgctggtttcggccacctggcccggggccacgacctgctc
atctgcacagctgagctgctgcagatggctctgaccagcactgaggaggaggagcacgtg
gagctcacagccttcaccctgctcgtggtggacgagtgtcaccacacgcacaaggacacc
gtctacaatgtcatcctcagccgctacctagagctcaaagtgcacaggacacagcccctc
ccccaggtgctgggactcaccgcctccccgggcactggcggggcctccaagctcgatgga
gccatcgaccacatcctgcagctctgtgccaacttggacacgtggcgcatcatgtcacca
gagcgctaccgctcccagctgctgcagctcaaccagaaacgctgcaagcagtatgacctc
tgccaccgccgcagccaggacccttttggggacttggtgaggaagatcatggaccaaatc
cacgaccacatggagatggaggagctgagccgggacttcggcacgcagacgtacgagcag
caggtggtggagctgagccaggcagcggcgaaggccgggctccaggagcagcgggtgcat
gcgcttcaccttcggcgctacaacgacgcgctgctcatccacgacacggtccgcgccgtg
gacgctctggacacgctgcaggatttctacgacagggagcgcaccactaaagcccggatc
ctgcatgccgagcgctggctgctggccctcttcgatgagcacaagaacacgctggcccgc
ttggcgacacagagccccgagaaccccaagctggagatgctggagaacatcctgcggaca
cagttcaggagccccgacagcccccggggcatcatcttcacccgcacccgccagagcgcg
cgctccctgctgctctgggttcagcagcagcccggcctgcagacagtggacatcaggccc
cagatgctgattggggcggggagcagcagccagagcacccacatgacccagagggaccag
gaagaggtgatccggaggttccgtgctggcatgctgaacctgctggtggccacgagtgtg
gtggaggaggggatggacattcctcactgcaatgtggtggtgcgctacgggctcctgacc
aacgagatctccatggtccaggccaggggccgagcccgggcagatcagagtgtgtactca
tttgtggcaacggagggcagccgggagctacggcgggagctgaccaatgagatgctggag
gcgctgatggagcaggcagtgggtgctgtgcagaagatggaccaggctgagtatcaggcc
aagatccgacagctgcagctggcagccctggtgcagcgcgccgcccgggccgaccagaag
gagcaggtgcggcagcaattcccggccgagcacgtgcggctcctgtgtgtaaactgcatg
gaggccgtgggccacgggagcgacctgcggaaggtggagggtgcccaccacgtcaacgtg
aaccccaacttctcgatctattatgctgtctcccgggatcccgtgcccatcaacagagag
ttcaaggactggaagccggggggtaccatccgctgcaggaactgtggggagagctggggc
ctgcagatgatctacaaatccgtgaagctgccggtgctcaaagtccgaagcatgctgctc
gagacccctcgagggcgcatccaggccaagaagtggtcccgcgtgcccttcccggtggcg
gacttcgacttcctgcagcactgcacccagagcctgtccgacctctcgctggactga

DBGET integrated database retrieval system