KEGG   Oryctolagus cuniculus (rabbit): 100347606
Entry
100347606         CDS       T03373                                 
Symbol
IL5RA
Name
(RefSeq) interleukin 5 receptor subunit alpha
  KO
K05067  interleukin 5 receptor alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100347606 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100347606 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100347606 (IL5RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100347606 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100347606 (IL5RA)
   04090 CD molecules [BR:ocu04090]
    100347606 (IL5RA)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL3 receptor family
   100347606 (IL5RA)
CD molecules [BR:ocu04090]
 Proteins
  100347606 (IL5RA)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind Interfer-bind
Other DBs
NCBI-GeneID: 100347606
NCBI-ProteinID: XP_017205681
LinkDB
Position
Un
AA seq 331 aa
MLPALLLLLGAAVLRGADTLPDQNLLLLPPVNLTIVVAGLARALLRWAPHPDQARQNVTV
DYHVRIHGPQEDEYETRSTVSTCVAPLHQGLSASVRAIVRDHGRLQAASRWVSAELEPPP
GPPGTAAVNLTCTTNTAAGDGTHAASYQVSLHCAWRAGEAAPADTQYFLYYRFGAETHEC
REYSRDSLQRNIACWFPRTSIHSKRRDRLAVLVNGSSRLTAIRPLDRLFALHAIDQVNPP
RNVTAKVQGARLSIEWQKPVSAFPSHCFDYEVQISDTRKAYVQTEKRTVNAFTSVIDNSS
RYCVQARATVSTTCRAAGLWSSWSPPFCVGE
NT seq 996 nt   +upstreamnt  +downstreamnt
atgctgccggcgttgctgctgcttctgggggcggcggtgctgcggggagcggacacactt
cctgaccagaacctcctcctcctcccccctgtcaacttgaccatcgtcgtcgctgggctg
gcacgagccctcctgcgctgggcgccacaccccgaccaagcgcgccagaacgtgactgtg
gactaccacgtgcggatccacggcccacaggaggacgagtatgaaaccaggagcaccgtg
agcacctgcgtcgcccccctgcaccaaggcctgtcggcgagcgtgagggccatcgtgaga
gaccacggccgcctccaggccgccagccgctgggtgtccgcggaactcgagcccccccca
gggcctcccggcaccgcggccgtgaacctgacctgcaccaccaacaccgcagcaggggac
ggcacgcacgccgcatcgtaccaggtttccctgcactgcgcctggcgggcgggcgaggca
gccccggcggatacacagtatttcctctactacaggttcggcgccgagacccacgagtgc
cgcgagtacagcagagactccctgcagaggaacatcgcgtgctggttccccaggacctcc
atccacagcaagaggcgggaccggctcgccgtgctcgtcaacggctcgagcaggctcacg
gccatcaggcccttggatcggctgtttgctctgcacgccatagaccaggtaaaccctccc
aggaacgtcacagccaaggtgcaaggagcccgtctctccatcgagtggcagaagcccgtg
tccgccttccccagccactgctttgactatgaagtgcagatcagcgacacgaggaaggct
tacgtccagacggagaaacggacagtcaatgccttcacctccgtgatcgacaacagttca
aggtactgcgttcaagcgcgagccacggtgagcaccacgtgccgggcggcggggctctgg
agctcatggagcccacccttctgcgtgggtgagtag

DBGET integrated database retrieval system