KEGG   Oryctolagus cuniculus (rabbit): 100347752
Entry
100347752         CDS       T03373                                 
Symbol
IL6R
Name
(RefSeq) interleukin 6 receptor
  KO
K05055  interleukin 6 receptor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04066  HIF-1 signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu04659  Th17 cell differentiation
ocu04932  Non-alcoholic fatty liver disease
ocu05163  Human cytomegalovirus infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100347752 (IL6R)
   04066 HIF-1 signaling pathway
    100347752 (IL6R)
   04151 PI3K-Akt signaling pathway
    100347752 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100347752 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100347752 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100347752 (IL6R)
   04659 Th17 cell differentiation
    100347752 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100347752 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100347752 (IL6R)
   05163 Human cytomegalovirus infection
    100347752 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100347752 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100347752 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100347752 (IL6R)
   04090 CD molecules [BR:ocu04090]
    100347752 (IL6R)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL6/12 receptor family
   100347752 (IL6R)
CD molecules [BR:ocu04090]
 Proteins
  100347752 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 Ig_2 ig I-set fn3
Other DBs
NCBI-GeneID: 100347752
NCBI-ProteinID: XP_002715384
UniProt: G1TBG5
LinkDB
Position
13:complement(38149107..38194929)
AA seq 544 aa
MCEWEVALTPSRARGCRAGPRDSRCAPRARLPGMAAAFGARARLALAARVTSRGGSKLAV
RCALLAALLAVGAAALAPGGCPVLEVASNVVSSQPGASVTLTCPGEELADNANVQWTLGG
PPETSRHGLWAGVGRRLLLRSVQLGDSGNYSCYLNGYPVGSVCLLVDVPPEEPRLSCFRR
SLISPVTCEWRPQRPPSPTTKAVLVVKKFLNGPANDFQKPCQYSHHSQKFSCQLAIPETD
RSSHIVSLCVANTVGSKSSRWEVFDGYEILQPDPPANITVTAMVGKPRWLHVTWQDPSSW
NSYFYRLRFELRYRAEQSQDFTAWMVEGRSHRVTRLGAQGLQHHSIIHDAWKGVRHVVQL
RAQEEFGHGSWSTWSAEVLGTPWTGTAATAAVAAEEEPESPPASSPATQASTATDGSTAP
SRGSTNTTSLPEDDSSPVPLSTFLVTGGSLAFGALLGAGVVLRFRKMWKLRALKEGKAGV
HPPYALGQLVPERPRPITVLVPLISPPVSPSSLGSDNAPGPSHPDAGCPRSPYDVSNKEY
FFPR
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtgcgagtgggaagtcgcgctgacaccgagccgggccagagggtgccgcgccgggccg
agggactcgcggtgcgcgccgcgcgcccgcctcccggggatggcggctgccttcggggcc
cgagcccgccttgccctggccgcccgggtcaccagccgaggaggaagcaagctggccgtc
cgctgcgcgctgctggccgccctgctggctgtgggggccgcggcactggccccggggggc
tgccccgtgctggaggtggcgagcaacgtggtgagcagccaaccgggagccagtgtcacc
ctgacctgtccaggtgaggaactggcagacaatgccaatgtgcagtggacgcttgggggt
ccaccggagacctcacgccatggcctgtgggctggtgtgggaaggaggctgctgctgagg
tcggtgcagctcggcgactctggaaactactcgtgctacctgaacggctatcccgttggc
tctgtgtgcctgctggtggacgttccccccgaggagccccggctctcctgcttccggagg
agcctcatcagccctgtgacttgtgagtggcgtcctcagaggccgccgtccccgacgacc
aaggctgtgctggtggtgaagaagttcctgaacggcccggcaaatgacttccagaagccg
tgccagtattctcaccactcccagaagttctcctgccagctggccatcccggagacagac
aggtcttcccacatcgtgtccctgtgcgtggccaacactgtgggcagcaagtccagccga
tgggaggtcttcgacggctatgagatcctgcagcccgacccgcctgccaacatcacggtc
accgccatggtcggaaagcctcgctggctccatgtcacctggcaagaccccagctcctgg
aactcctatttctacaggctgcggttcgagctccggtaccgggctgagcagtcgcaggac
ttcacagcatggatggtagaaggccggagtcaccgcgtcacccgcctgggggcccagggc
ctccagcaccatagcatcatccatgacgcctggaagggcgtgaggcatgtcgtgcagctc
cgggcccaggaggagtttgggcatggctcatggagtacgtggagtgccgaggtcctgggc
accccttggacaggtacggcggcgacggcggcggtggcggcagaggaagagcccgagagc
cctccggcctcgtcccccgccacgcaggcatccactgctactgacggcagcactgctccc
tccagaggttctacaaacacaaccagcctcccagaagatgattcctccccagtcccgctg
tccacgttcctggtgactggagggagcctggcgttcggggcgctgctcggcgctggcgtt
gtcctgaggttcaggaagatgtggaagctgcgagctctgaaggaaggcaaggcgggggtg
cacccgccctacgcgctgggccagctggtccccgagaggcccaggcccatcaccgtgctg
gtgcccctcatctccccacccgtgtcccccagcagcctcggctctgacaacgccccgggt
cccagccacccagacgccggctgcccgcggagcccttatgatgtcagcaacaaagaatac
ttcttccccagatag

DBGET integrated database retrieval system