KEGG   Oryctolagus cuniculus (rabbit): 100347811
Entry
100347811         CDS       T03373                                 
Symbol
IL34
Name
(RefSeq) interleukin 34
  KO
K22633  interleukin 34
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100347811 (IL34)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100347811 (IL34)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100347811 (IL34)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100347811 (IL34)
SSDB
Motif
Pfam: IL34
Other DBs
NCBI-GeneID: 100347811
NCBI-ProteinID: XP_002711723
UniProt: G1U8A5
LinkDB
Position
5:complement(28855632..28917120)
AA seq 200 aa
MPRGIAWLRYLGILLGMVLGNKGLEVWPLTDSKDCTVTGFLRDKLQYRNRLQYMKHYFPI
NYRIGVPYEGVLRIANITRLQRARVSERELRYLWVLVSLSAAESVQEVLLEGHPSWKYLQ
EVQTLLLNVQQDLLDVEVSPKVEAVLSLLNAPGLSLKLVRPKALLDNCFRVMELLYCSCC
KRSSVLNWQDCEVPSPQPRG
NT seq 603 nt   +upstreamnt  +downstreamnt
atgccccggggaatcgcctggctgcgctatcttgggatcctcctgggcatggtcttgggg
aacaagggcttggaggtgtggcccttgactgacagcaaggactgcaccgtcaccggcttc
ctgcgggacaagctgcagtacaggaaccggcttcagtacatgaaacactacttccccatc
aactacaggatcggcgtgccttacgagggggtgctgagaatcgccaacatcaccaggctg
cagagggcccgggtaagcgagcgggagctgcggtatctgtgggtcctggtgagtctcagc
gctgccgagtcggtgcaggaagtgttgctcgagggccacccgtcctggaagtacctgcag
gaggtgcagacgctgctgctgaacgtccagcaggacctcctggatgtggaggtcagcccc
aaggtggaggcagtgctgtcgctcctgaacgccccggggctgagcctcaagctggtgcgg
cccaaagccctgctggacaactgcttccgggtcatggagctgctctactgctcttgctgt
aagcggagctccgtccttaactggcaggactgcgaggtgccgagcccgcagccccgcggc
tga

DBGET integrated database retrieval system