KEGG   Oryctolagus cuniculus (rabbit): 100347856
Entry
100347856         CDS       T03373                                 
Name
(RefSeq) calmodulin-like protein 3
  KO
K02183  calmodulin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04070  Phosphatidylinositol signaling system
ocu04114  Oocyte meiosis
ocu04218  Cellular senescence
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04371  Apelin signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04713  Circadian entrainment
ocu04720  Long-term potentiation
ocu04722  Neurotrophin signaling pathway
ocu04728  Dopaminergic synapse
ocu04740  Olfactory transduction
ocu04744  Phototransduction
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04910  Insulin signaling pathway
ocu04912  GnRH signaling pathway
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04921  Oxytocin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04924  Renin secretion
ocu04925  Aldosterone synthesis and secretion
ocu04970  Salivary secretion
ocu04971  Gastric acid secretion
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05031  Amphetamine addiction
ocu05034  Alcoholism
ocu05133  Pertussis
ocu05152  Tuberculosis
ocu05163  Human cytomegalovirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05214  Glioma
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100347856
   04015 Rap1 signaling pathway
    100347856
   04371 Apelin signaling pathway
    100347856
   04020 Calcium signaling pathway
    100347856
   04070 Phosphatidylinositol signaling system
    100347856
   04024 cAMP signaling pathway
    100347856
   04022 cGMP-PKG signaling pathway
    100347856
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100347856
   04218 Cellular senescence
    100347856
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100347856
  09152 Endocrine system
   04910 Insulin signaling pathway
    100347856
   04922 Glucagon signaling pathway
    100347856
   04912 GnRH signaling pathway
    100347856
   04915 Estrogen signaling pathway
    100347856
   04921 Oxytocin signaling pathway
    100347856
   04916 Melanogenesis
    100347856
   04924 Renin secretion
    100347856
   04925 Aldosterone synthesis and secretion
    100347856
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100347856
   04270 Vascular smooth muscle contraction
    100347856
  09154 Digestive system
   04970 Salivary secretion
    100347856
   04971 Gastric acid secretion
    100347856
  09156 Nervous system
   04728 Dopaminergic synapse
    100347856
   04720 Long-term potentiation
    100347856
   04722 Neurotrophin signaling pathway
    100347856
  09157 Sensory system
   04744 Phototransduction
    100347856
   04740 Olfactory transduction
    100347856
   04750 Inflammatory mediator regulation of TRP channels
    100347856
  09159 Environmental adaptation
   04713 Circadian entrainment
    100347856
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100347856
  09162 Cancer: specific types
   05214 Glioma
    100347856
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100347856
   05163 Human cytomegalovirus infection
    100347856
   05167 Kaposi sarcoma-associated herpesvirus infection
    100347856
  09171 Infectious disease: bacterial
   05133 Pertussis
    100347856
   05152 Tuberculosis
    100347856
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100347856
   05012 Parkinson disease
    100347856
   05022 Pathways of neurodegeneration - multiple diseases
    100347856
  09165 Substance dependence
   05031 Amphetamine addiction
    100347856
   05034 Alcoholism
    100347856
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100347856
   05418 Fluid shear stress and atherosclerosis
    100347856
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100347856
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100347856
   03036 Chromosome and associated proteins [BR:ocu03036]
    100347856
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100347856
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100347856
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100347856
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     100347856
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100347856
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 AIF-1 EF-hand_FSTL1 Allatotropin-like_C SPARC_Ca_bdg EF-hand_9 EH CFAP251_C EF-hand_STIM1 EF-hand_EFHB_C Dockerin_1 TerB EF_SSP120 DUF5580_M EF_EFCAB10_C EF-hand_11 UPF0154 Temptin_C EF-hand_SWAP70_N DUF3349 SCO1-SenC ERAP1_C SurA_N_2
Other DBs
NCBI-GeneID: 100347856
NCBI-ProteinID: XP_002721725
Ensembl: ENSOCUG00000012622
UniProt: G1T3Q4
LinkDB
Position
Unknown
AA seq 149 aa
MAEELSPEQVAEFKQAFSRFDKNGDGTISVEELGAVMQLLGKKLSEEELKALITRVDKDG
DGAISFQEFLAEMVRMMKAGGSEQDLREAFRAFDLNGDGHISVEELKQVMSKLGEKLSHE
ELNAMIQEADTDKDGKVNYEEFMHIFTQK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgaggagctgtctccagagcaggtggctgagttcaagcaggccttctccaggttc
gacaagaatggggatggcaccatcagcgtcgaggagctgggtgcagtgatgcagttgctg
ggcaagaagctctcggaggaggagctgaaggctctcatcacccgagtggacaaggatgga
gacggagccatcagcttccaagagttcctggcagagatggtcaggatgatgaaggcaggg
ggcagtgagcaggacctgcgggaagctttccgagcctttgacctgaatggtgacggccac
attagtgtggaagagctcaagcaggtcatgagcaagctgggggagaagctttctcatgag
gagctgaatgctatgatccaagaggccgacacagacaaggatggcaaggtgaactacgag
gaattcatgcacattttcacccaaaagtga

DBGET integrated database retrieval system