KEGG   Oryctolagus cuniculus (rabbit): 100348025
Entry
100348025         CDS       T03373                                 
Symbol
IL13RA2
Name
(RefSeq) interleukin 13 receptor subunit alpha 2
  KO
K05077  interleukin 13 receptor alpha-2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100348025 (IL13RA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348025 (IL13RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100348025 (IL13RA2)
   04090 CD molecules [BR:ocu04090]
    100348025 (IL13RA2)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL3 receptor family
   100348025 (IL13RA2)
CD molecules [BR:ocu04090]
 Proteins
  100348025 (IL13RA2)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind LIFR_N
Other DBs
NCBI-GeneID: 100348025
NCBI-ProteinID: XP_008271125
Ensembl: ENSOCUG00000014747
LinkDB
Position
X:complement(63501691..63566737)
AA seq 382 aa
MAFICLYNRCLAIFLICIAFGYTSSSDLEIKVNPPEDFEIVDPGYLGFLYLQWQPPVSLE
NFKACAVEYELKFRSIGGGRWKTVITKNLRYKYGFDLNKGIEAKIHTLLPKQCTNGSEVR
SLWSEATYWMPEQGNLETKIKDMDCIYYNWQNLLCSWEPGKGVHFDANYYLFYWYEGLDH
ALQCTDYIKANGKNVGCRFPQLESPDYKDFYVCVNGSSESKSIRSSYFIFQLQNIVKPLP
PDYLSINVKNLLEVNLQWSIPRGSIPAKCFIYEIEFTEGDIAWVTTTFDNEMCIMRTSNG
SHELCFSTRSKVNIYCADDGIWSEWSNEKCWKGETWKETLSFFVIPFSVVSLCILLTTCL
VLYKQKSVLKMIFHAKKETFPH
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggctttcatttgtttgtataacagatgcctggctatctttctcatttgcatagcattt
ggctatacttcgtcttcagatcttgagataaaagttaatccccctgaggattttgagata
gttgatcctggatatttaggtttcctgtatttacaatggcaacctccagtatctctggaa
aatttcaaggcatgtgcagtagaatatgaactaaagtttcgaagcattggtggtggaaga
tggaagactgtcattactaagaatctacgttacaaatatggatttgatctaaacaagggc
attgaagccaaaatccacacgcttttgccaaagcaatgcacgaatggatcagaagttcga
agtttgtggtcagaagctacttactggatgccagaacaaggaaatttggaaaccaaaatt
aaagatatggattgcatatattacaactggcaaaatttgctctgttcttgggaacctggc
aagggtgtacactttgatgccaattactacttgttttattggtatgagggcttggatcat
gcattacagtgtactgattatatcaaggctaatggaaaaaatgtcggatgcaggtttccc
caattggagtcaccagactataaagatttctatgtctgtgttaatggatcatcagaatcc
aagtctattagatccagctatttcatttttcagcttcagaatatagtgaaacctttgcca
ccagactatcttagtattaacgtgaagaatttacttgaagttaacctgcagtggagcata
ccaagaggatctatcccagccaagtgctttatttatgaaattgagttcactgaaggcgat
attgcttgggtgaccaccacatttgataatgaaatgtgcatcatgagaacatcaaatgga
agtcatgagttatgcttttcaacaagaagcaaagtgaacatttattgtgcagatgatggg
atttggagtgagtggagtaatgaaaaatgttggaaaggtgaaacatggaaagaaactttg
tcattttttgtgataccattttctgttgtgtcactttgtattttgttaacaacctgtttg
gttttgtataagcaaaaatctgtactgaaaatgatttttcatgcgaaaaaggaaactttt
cctcattga

DBGET integrated database retrieval system