Oryctolagus cuniculus (rabbit): 100348266 Help Entry 100348266         CDS       T03373                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine ligand 5   KO K12499   C-C motif chemokine 5 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04061   Viral protein interaction with cytokine and cytokine receptor ocu04062   Chemokine signaling pathway ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04623   Cytosolic DNA-sensing pathway ocu04668   TNF signaling pathway ocu05020   Prion disease ocu05142   Chagas disease ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05168   Herpes simplex virus 1 infection ocu05323   Rheumatoid arthritis ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     100348266 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100348266 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     100348266 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100348266 (CCL5)    04621 NOD-like receptor signaling pathway     100348266 (CCL5)    04623 Cytosolic DNA-sensing pathway     100348266 (CCL5)    04062 Chemokine signaling pathway     100348266 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     100348266 (CCL5)    05168 Herpes simplex virus 1 infection     100348266 (CCL5)    05163 Human cytomegalovirus infection     100348266 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     100348266 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     100348266 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     100348266 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100348266 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:ocu04052]     100348266 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     100348266 (CCL5) Cytokines and growth factors [BR:ocu04052]  Cytokines   Chemokines    100348266 (CCL5) Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Chemokines    100348266 (CCL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100348266 NCBI-ProteinID:  XP_017204526 Ensembl:  ENSOCUG00000002848 UniProt:  G1SIG1 LinkDB All DBs Position 19:complement(24923608..24932154) Genome browser AA seq 91 aa AA seqDB search MEVSAAALAVLLTAAALCAPASASPYASDTTPCCFAYISRLLPRAHVTEYFYTSGKCSFP AVVFVTRKNRQVCANPEKKWVREYINSLEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggaggtctccgccgccgccctcgccgtcctcctcaccgctgctgccctctgcgcacct gcatctgcctccccatatgcctcggacaccacgccctgctgctttgcctacatctcccgc ctgctgccccgggcccacgtcacggagtatttctataccagcggcaagtgctccttcccg gcagttgtctttgtcaccaggaagaaccgccaggtgtgtgccaacccagagaagaaatgg gttcgggagtacatcaactctttggagatgagctaa

DBGET integrated database retrieval system