KEGG   Oryctolagus cuniculus (rabbit): 100348299
Entry
100348299         CDS       T03373                                 
Symbol
ANAPC1
Name
(RefSeq) anaphase promoting complex subunit 1
  KO
K03348  anaphase-promoting complex subunit 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100348299 (ANAPC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100348299 (ANAPC1)
   04114 Oocyte meiosis
    100348299 (ANAPC1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100348299 (ANAPC1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100348299 (ANAPC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100348299 (ANAPC1)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100348299 (ANAPC1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100348299 (ANAPC1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100348299 (ANAPC1)
SSDB
Motif
Pfam: Apc1_MidN Apc1_N APC1_C ANAPC1 PC_rep
Other DBs
NCBI-GeneID: 100348299
NCBI-ProteinID: XP_002709632
Ensembl: ENSOCUG00000012926
UniProt: G1TFT3
LinkDB
Position
2:complement(96748374..96847849)
AA seq 1944 aa
MSNFYEEKATMIAAGDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGS
LQEVTIHEKQKESWQLRKGVSEIGEEVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVD
SPVQQALWCDFIISQDKSEKTYSSYEVEKCICILQSSCINMHSIEGKDYIASLPFQVANV
WPTKYGLLFERSSSSHEVPPGPPREPLPTMFSMLHPLDEITPLVCKSGGLFGSTRVHYVV
DPAMKIVFLNIDPSIVMTYDSVQNVHSVWTLRRVKPEEENAVLKFSEQGGTPQNAATSSS
LTAHLRSLSKGDSPVASPFQNYSSIHSQSRSASSPSLHSRSPSISNMAALSRAHSPALGV
HSFSGVQRFNVSSHNQSPKRHSISHSPTSNSNGSFLAPETEPIVPELCIDHLWTETITNI
REKSSQASKVFITTDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSVTNIHAKDAA
PVEKIDTMLVLEGSGNLVLYTGVVRVGKVFIPGLPAPSLTMSNTMPRPSTPLDGVSTPKP
LSKLLGSMDEVVLLSPVPELRDSSKLHDSLYNEDCTFQQLGTYVHSVRDPVHNRVTLELS
NGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYNVHSAPGGPSYHSEWNLF
VTCLMNLMGYNTDRLAWTRNFDFEGSLSPVIAPKKARPSDTGSDDDWEYLLNSDYHQNVE
SHLLSRSLCLGPLEVSQMKDEDFSQNLSLDSSTLLFSHIPAIFFVLHLVYEELKLNTLMG
EGICSLVDLLVQLARDLKLGPYVDHYYRDYPTLVRTTGQVFAIDPGQTGFMHHPSFFTTE
PPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALYILGDESSVSNDASQYLSRIT
VAPQKPQAEQEENRFTFRHSTSVSSLAEKLVVWMTNVGFTLRDLETLPFGIALPIRDAIY
HCREQPASDWPEPVCLLIGRQDLSKQACEGNLPRGKSVLSSDVPSGTEAEEEDDGMNDMN
HEVMSLIWSEDLRVQDVRRLLQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMAL
PVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNG
VAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKG
HEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLV
YQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLN
VPEQLYQYMVGGHRRFQAGMHREKHKSPSYQIKEGDTINVDVTCPGATLALAMIYLKTNN
RSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSIS
LSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLS
APNASVTGPYNLETCLSVVLLSLAMVMAGSGNLKVLQLCRYLHMKTGGEMNYGFHLAHHM
ALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLV
PVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDL
SKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISA
FTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRL
GRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFMNSEFLPVVKCTIDNTLDQWL
QAGGDMCVHAYLSGQPFEESQLSMLACFLVYHSVPAPRHLPSVALEGSTSFAELLFKFKQ
LKMPVRALLRLAPLLLGNPQPMVM
NT seq 5835 nt   +upstreamnt  +downstreamnt
atgtcgaacttctatgaagaaaaggcaacaatgattgcagccggggatttgcaggaattt
gttcctttcggtcgagaccactgcaagcaccaccctaatgctttgaaccttcagcttcgc
caactgcagccagcctctgaattatggtcgtctgatggtgctgctggcttggtgggatcc
cttcaggaggttacaatccacgagaaacaaaaggaaagctggcagctaaggaaaggtgtc
agtgaaattggagaagaagtggactatgatgaggagctctatgtggctggaaatatggtg
atctggagcaaaggaagtaagagccaggctctggcagtttataaagcgttcacagttgac
agtcctgttcagcaggcattgtggtgtgacttcattatatcacaggataagtctgaaaag
acctacagtagctatgaagtagaaaaatgcatatgtatattgcaaagctcatgtattaac
atgcacagcatagaaggaaaggattacatagcttccttaccatttcaggttgcaaatgtt
tggcccactaaatatggattgttgtttgaacgaagcagttcttcacatgaggtgcctcca
ggtccacccagagaacctttacccaccatgttcagcatgctgcacccactagatgaaata
accccccttgtttgtaaatctggaggtctttttggttcgacacgggtgcattatgttgta
gatccagcaatgaaaattgttttccttaacattgacccctccatcgtaatgacctatgac
tctgttcagaatgtgcattctgtgtggactctccggagagtcaagccagaggaagagaat
gctgttttaaagttctctgagcaggggggaaccccacagaacgcggccaccagcagctcc
ctcacagcacatctcagaagcctctccaaaggagattctcccgtggcttcccctttccag
aattactcctccattcacagccagagccgttcagcctcatcacccagcctgcattcccgc
tcaccttcgatttccaacatggcagctctcagtcgtgcccattctcctgccttaggagtg
cattctttttcaggagtgcaaaggttcaatgtttcaagccataatcagtctccaaagaga
cacagtatttctcattctccaaccagcaattccaatggctcctttcttgcaccagaaaca
gagccaattgttcctgagctgtgtattgaccatttgtggacagaaacgatcactaatata
agggagaaaagttcacaagcctcaaaagtgtttattacaactgatctgtgtggacaaaag
ttcttgtgctttttagtagagtctcagctccagttacgctgtgtgaagttccaagagagt
aatgataaaacccagctcatctttggctctgtcaccaatatacatgcaaaagatgcagca
ccagtggagaagatagataccatgctggtcttggaaggcagtggaaacttggtgctgtat
acaggagtggttcgggtgggaaaggttttcattcctggactgccagctccttccctgaca
atgtccaacacgatgcctcggcccagtactcctcttgatggtgttagtactcctaaacct
ctcagtaaactgcttggatcgatggatgaggttgttttgttgtctccggttccagaactg
agggattcttcaaaactccacgattctctctataacgaggactgtactttccaacagctt
ggcacttacgttcattctgtcagagatcctgtccataacagagtgactttagaactaagt
aatggctccatggttaggatcactattccggaaattgccacgtctgaattagtacaaact
tgtctgcaagcaattaagtttatcctgccaaaagaaatagcggttcagatgcttgttaag
tggtacaatgtccacagtgctccaggaggacccagttatcactcagagtggaatttgttt
gtaacttgtctcatgaacttgatgggttataacacagaccgcttagcttggacccgaaat
tttgattttgaagggtctctttctccagtcattgcgcccaaaaaagcaaggccttcggat
actggatctgatgatgactgggaatatttactaaattcggactaccaccagaatgtcgag
tctcatcttttgagcaggtctctgtgtttgggtcctttggaggtttcacagatgaaggat
gaggatttttcacagaacctcagtctggattcttctacacttctctttagtcacatacct
gcaattttctttgttcttcaccttgtctatgaggagcttaagttgaatactctgatggga
gaaggaatttgctcgcttgttgacctccttgttcagttggccagagacttaaaattggga
ccttacgtagatcattactatagagactatccaacgctcgtcagaactactggacaagtg
ttcgcaattgatccaggtcaaacaggatttatgcatcatccgtcattttttacaactgag
ccaccaagtatttatcagtgggtgagttcttgtctgaagggtgaaggaatgccaccttat
ccttacctccctggaatctgtgaaagaagcagactggtggttttgagtattgcactctac
atacttggtgatgagagctcggtttctaatgacgcctcacaatatttatccagaataact
gtagccccccagaaaccacaagcagaacaagaggaaaacaggtttactttcaggcattct
acatcagtttctagcctagcagaaaaattagttgtctggatgacaaatgtaggattcact
ttaagagatttggaaacacttccctttggaattgcccttcctatcagagatgcaatttat
cactgtcgtgagcagcctgcttcagattggccagaacctgtctgcctcttaattggacgt
caagatctttctaagcaagcttgtgaaggaaacttacctagagggaaatctgtactctca
tcagatgttccttcaggaacagaagctgaggaagaagacgatggcatgaatgacatgaat
catgaggttatgtcattaatttggagtgaagatttaagggtgcaggatgtacgaaggctt
cttcaaagcgcacatcctgttcgtgtcaatgtagtgcaatacccggaactcagtgaccat
gagttcattgaagaaaaagaaaacagattgctccaattgtgtcagcgaaccatggccctt
ccagtaggacgagggatgtttaccttgttttcataccatcctgttccaacagaacccctt
cctattcctaaattgaatctcaccgggcgtgcccctcctcggaatacaacagtggacctt
aatagtggaaacatcgatgtgcctcccaacatgacaagctgggccagctttcataatggt
gtggctgctggcctgaagatagcccctgcctcccagatcgactcagcttggattgtttac
aataagcccaagcatgcagagttagccaatgagtatgcaggctttctcatggccctgggt
ctgaatgggcaccttaccaagctggctactctgaatatccatgactacttgaccaagggc
catgaaatgacaagcattggacttctgcttggtgtttctgctgcaaaactaggcaccatg
gatatgtcaattactcggcttctcagcattcacattcctgctctcttacccccaacgtcc
acagaacttgatgttcctcacaatgttcaagtggctgcagtggttggcattggccttgta
tatcaagggacagctcatagacatacagcagaagtcttactggctgaaataggacgcccc
cctggccctgaaatggagtactgtaccgacagagagtcatactctttagctgctggcctg
gccctgggcatggtttgcttggggcacggcagtaacctgatagggatgtctgacctcaat
gtgcctgagcagctttatcagtacatggttggaggtcacaggcgctttcaagcagggatg
cacagggagaaacataaatctccaagttaccaaatcaaggaaggagataccataaatgtg
gatgtgacttgtccaggtgctactctagctttggctatgatctatttaaaaactaataac
agatccattgcagattggcttcgggctcctgataccatgtatttgctggactttgtgaaa
ccagagtttctgttgcttaggacacttgctcgatgcctgattttgtgggatgatatttta
ccaaattccaagtgggttgacagcaatgttcctcagattataagagaaaatagtatctct
ctcagtgaaattgaattgccttgctcagaggacttgaatttagaaactttatcgcaagca
catgtctacataattgcaggagcctgcttgtctctgggttttcggtttgccggctcagaa
aatttatcagcatttaactgcctgcataaatttgcaaaagatttcatgacctatctgtct
gcacctaatgcttctgtaacaggcccgtacaacttggagacttgcctgagtgtggtattg
ctgtctcttgccatggtaatggctggctcggggaacctgaaggtgttgcagctttgccgc
tacttgcacatgaaaacaggtggtgaaatgaactatggctttcacctagcccaccacatg
gccctggggcttctgtttttgggaggaggaaggtactccttgagcacatcaaactcttcc
attgctgctctcctctgtgccctttacccgcacttcccagcccacagcactgacaaccgg
tatcatctccaggctctccggcatctctatgtgctggctgcagaaccgaggcttctggtg
ccagtggatgtggacaccaacactccctgctatgccctcttggaggttacctacaagggc
actcagtggtatgaacaaaccaaagaagaattgatggctcctacccttcttccagaactc
caccttttaaaacagattaaagttaaaggcccaaggtactgggaactgcttatagatttg
agcaagggaacacaacacttgaagtccatcctttccaaggatggggttttatatgttaag
ctcagggcgggtcagctctcctacaaggaagatccgatggggtggcaaagtttgttggcc
cagactgttgccaataggaactctgaagctcgggctttcaagccagaaacaatttcagca
ttcacttctgatccagctcttctgtcatttgctgaatacttctgcaagccaactgtgaat
atgggtcagaaacaggaaattctggatctcttttcttcagtgctctatgaatgtgtgact
caggagactccagagatgctccctgcctacatagcaatggaccaggctataagacgactt
ggaagaagagaaatgtctgagacatctgaactttggcagatcaagttagtgttggagttt
ttcagctcacgaagccatcaggagcggctgcagaaccaccctaagcgcgggctctttatg
aactctgaattcctgcctgttgtgaagtgcaccattgataacaccctggaccagtggctc
caagccgggggtgacatgtgtgtgcacgcctacctcagtgggcagcccttcgaggaatct
cagctgagcatgctggcctgcttcctcgtctaccactcggtgcctgctccgcgccacctg
ccgtctgtggcactagaaggaagcacaagctttgccgaactgctcttcaagtttaaacag
ctgaaaatgccggtgcgagctttgctgcgattggctcctttgctgcttggaaacccacag
ccaatggttatgtga

DBGET integrated database retrieval system