KEGG   Oryctolagus cuniculus (rabbit): 100348362
Entry
100348362         CDS       T03373                                 
Symbol
CCL19
Name
(RefSeq) C-C motif chemokine ligand 19
  KO
K05512  C-C motif chemokine 19
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100348362 (CCL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348362 (CCL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100348362 (CCL19)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100348362 (CCL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348362 (CCL19)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100348362 (CCL19)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100348362
NCBI-ProteinID: XP_002707983
Ensembl: ENSOCUG00000001515
UniProt: G1SFK8
LinkDB
Position
1:19132272..19133916
AA seq 102 aa
MAPGAAQLLALSLLVLWTSLAPALGGANDAEDCCLSVTQRPIPSNIVRAFRYLLVTDGCR
VPAVVFTTLRGFQLCAPPEQPWVGRIIRRLKRISAKGKYQSS
NT seq 309 nt   +upstreamnt  +downstreamnt
atggcccctggtgcagcccagctcctggccctcagcctgctggttctctggacttccctg
gcaccagctctgggtggtgctaatgatgctgaagactgctgcctgtctgtgacccagcgc
cccatccccagcaacatcgtgagagcctttcgctacctgctcgtcaccgatggctgccga
gtacctgctgtagtgttcaccacactgaggggcttccagctctgtgcacccccggaacag
ccctgggtgggccgcatcattcggagactgaagcggatctctgccaagggcaagtaccag
agcagttag

DBGET integrated database retrieval system