KEGG   Oryctolagus cuniculus (rabbit): 100348414
Entry
100348414         CDS       T03373                                 
Symbol
BMP3
Name
(RefSeq) bone morphogenetic protein 3
  KO
K05496  bone morphogenetic protein 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348414 (BMP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348414 (BMP3)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100348414 (BMP3)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide Rsm1
Other DBs
NCBI-GeneID: 100348414
NCBI-ProteinID: XP_002717136
Ensembl: ENSOCUG00000000658
UniProt: G1SDS6
LinkDB
Position
15:complement(69212394..69238987)
AA seq 475 aa
MAWARGLLCLWLSCVCVSLARTERPRQPFPELRKAGPGDRAAGGGPGPELQPHDKVSEHM
LRLYDRYSGGGRVQAPRTPGSRERGSQPAHPQPLREGNTVRSFRAGAAGAVESKGLHIFN
LTSLTKSENILSATLYFYSGELVNTNLSCPVSQGCSHHAKRKPVQIVLSAWILKSDRNQS
QPLGHLSVDVAKSHRDVTPWLSKDITQLLRKAKEKEEFLIGFNITSKAHQLPKRMLLSPE
PYILVYANDAAISEPESVVSSLQGHRNFPTGSVPKLDRHIRAALSVERRKKRSTGVLLPL
QNNELPGAEYQYKEEGVWEERKPYKTLQTQPPEKSKNKKKQRKGPHQKSQTLQFDEQTLK
KARRKQWLEPRDCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHA
TIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcctgggcgcgcgggctgctctgtctgtggctgagctgcgtctgcgtgagcctggcg
cggacggagaggccgaggcaaccgttcccggagctccgcaaagctgggccaggggaccgc
gcggcaggtggtggcccgggcccggagctgcagccgcacgacaaggtgtccgagcacatg
ctgcggctctatgacaggtacagcggtggcggcagggtccaggcgccacggacgccaggc
tcgcgggagcggggctcgcagcccgcgcacccccagcccctgcgcgaaggcaacaccgtg
cgcagcttccgagcgggagcagcaggagctgttgaaagcaagggactacatatttttaat
ctgacttctctaaccaagtctgaaaatattttatcagccacactgtatttctattctgga
gagctggtaaacaccaacctgagttgtccagtgtcccagggatgctcacaccatgccaag
aggaagcctgttcagatagttctctctgcatggattctcaaatcggacaggaaccaaagt
cagcccctcggtcatctctcagtagacgtagccaaatctcaccgagatgtcacaccctgg
ctctctaaagatatcactcaactcttgaggaaggccaaggagaaggaggagttcctcatt
ggatttaacatcacctccaaagcccaccagctgccaaagaggatgttactctctccagag
ccttatatcctggtgtatgccaatgacgctgccatttctgagccagaaagtgtagtatca
agcttacaaggacaccgcaatttccccactggttctgtgcccaaattggataggcacatc
agagctgccctttctgttgaacggagaaaaaagcgctctactggggtcttgttgcctttg
cagaacaatgagcttcctggggcagaatatcagtataaggaggagggcgtatgggaggag
agaaagccttacaagactcttcagacccagccccctgagaaaagtaagaacaaaaagaaa
cagaggaaggggccccatcagaagagccagacactccagttcgatgagcagactctgaag
aaggcaagaagaaagcaatggcttgaacctcgggactgtgccagaagataccttaaggta
gactttgcagatattggctggagtgaatggattatctcccccaagtcctttgatgcgtat
tactgctcaggagcatgccagttccccatgccaaagtctttgaaaccatcaaatcatgct
accatccagagtatagtgagagctgtgggggtcgttcctgggattcctgagccttgctgt
gtcccggaaaagatgtcttcactcagtatcttattctttgatgaaaataagaatgtagtg
ctcaaagtatatcctaacatgacagtagagtcttgtgcttgcagataa

DBGET integrated database retrieval system