KEGG   Oryctolagus cuniculus (rabbit): 100348428
Entry
100348428         CDS       T03373                                 
Symbol
CXCL16
Name
(RefSeq) C-X-C motif chemokine ligand 16
  KO
K10035  C-X-C motif chemokine 16
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348428 (CXCL16)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100348428 (CXCL16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348428 (CXCL16)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100348428 (CXCL16)
SSDB
Motif
Pfam: IL8 PROL5-SMR
Other DBs
NCBI-GeneID: 100348428
NCBI-ProteinID: XP_008269049
LinkDB
Position
19:complement(12271579..12278300)
AA seq 338 aa
MSPSRPSPSRPLHSSGTCSRHHFRRKLWPGGAGAWRLCLPGNSPGRTPQRPLWTGCRVRV
GVRGCWAPGPAPSAASGSEIADGHGEEAKVAEKPADATVRSGQGSLTRRLEMSRRQVRLL
LLLAALALSVSANEGSVTGSCHCDQIISSSSPPNPKLMEHFRKHLRAYHRCTAYIRFRLH
SRSVCGGNHDPWVHELLRCFDRGECGRAHWESLAHRKPLPSRSTQIPKYTEEASAHLPST
AQTHLPPTLPPGAHANKTTTAPPSQSLEVGPEAGQNQKQLEEIVGPAAGTSAMVPVLTLL
AITFLLTGVLMYVLCKRRRGRSPKYSSDLQLYHTRVAQ
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgagccccagcagacctagcccctcccggccgctccactcctccggtacctgcagccgc
caccactttcgaaggaagctctggcccgggggtgcgggggcgtggagactctgcctcccg
gggaattctcccgggcggacgccgcagcggcccctctggaccgggtgcagagtccgtgtg
ggagtgcgtgggtgctgggctccgggacccgcgccctccgccgcctccggctcggagata
gcggacgggcacggggaggaagcgaaagtcgcagagaagccagcggacgccacagtccgg
agcggacagggcagtctcacgcggcgcctcgagatgtccaggcgtcaggtacgcctgctg
ctgctgctggcagcgcttgccctctcggtcagtgccaacgagggcagcgtcacagggagc
tgtcactgcgaccaaataatttcttccagctccccgccgaatccaaagttaatggaacac
ttccgaaaacatctcagggcctaccaccgctgtacagcctacatcaggttccggctgcac
tcgcggagcgtgtgcggaggcaaccacgacccgtgggtgcacgaactgctgagatgcttc
gaccgcggagaatgtggacgcgctcactgggagagtctggcccaccggaagccgctacct
tcccgcagcactcagattcccaagtacacagaggaggcatccgcacacctgccctccact
gcccagacccacctgccacccaccctgccacccggagcgcacgccaacaaaaccaccact
gcccctccgagccagagtctggaggttgggcctgaagctgggcagaaccagaagcagcta
gaagaaattgtaggacctgcagccgggacgtcagccatggtgccggtgctgacccttctg
gccatcaccttcctcctcactggagtcctcatgtatgtgctgtgcaagcggagaaggggg
cgctccccaaagtactcttcagatttgcagctttatcatacacgtgtggcacaataa

DBGET integrated database retrieval system