KEGG   Oryctolagus cuniculus (rabbit): 100348484
Entry
100348484         CDS       T03373                                 
Symbol
MAP3K1
Name
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04530  Tight junction
ocu04622  RIG-I-like receptor signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04912  GnRH signaling pathway
ocu04935  Growth hormone synthesis, secretion and action
ocu05161  Hepatitis B
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100348484 (MAP3K1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100348484 (MAP3K1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100348484 (MAP3K1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100348484 (MAP3K1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100348484 (MAP3K1)
   04935 Growth hormone synthesis, secretion and action
    100348484 (MAP3K1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100348484 (MAP3K1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100348484 (MAP3K1)
   05161 Hepatitis B
    100348484 (MAP3K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100348484 (MAP3K1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100348484 (MAP3K1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100348484 (MAP3K1)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: STE group
  STE11 family
   100348484 (MAP3K1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100348484 (MAP3K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal zf-RING_2 ABC1 PHD APH zf-ANAPC11
Other DBs
NCBI-GeneID: 100348484
NCBI-ProteinID: XP_017200218
Ensembl: ENSOCUG00000009155
LinkDB
Position
11:72741026..72775914
AA seq 1345 aa
MENKETLKGLHKMDDRPEERMIREKLKATCMPAWKHEWLERRNRRGPVVVKPIPIKGDGS
EMSNLAAECQGEGQVGAASPAPKGRRSPSPSSSPSGRIVKSESPGVRRKRVSPVPFQSGR
ITPPRRAPSPDGFSPYSPEETNRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIG
PQNCSCGRGTFCIHLLFVMLRVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAP
SRNTIQKFVSRMSNSHTLSSSSTSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCEDGC
RNKLHHHCMSIWAEECRRNREPLICPLCRSKWRSHDFYSHELSSPVDSPSSLRTAQQQTL
QQPPLAGSQRRTQESNFNLTHYGTQQIPPAYKDLAEPWIQVFGMELVGCLFSRNWNVREM
ALRRLSHDVSGALLLANGESTGNSGGSGGSSPSVGAASGSPQASVSGDVVEACCNVLSVV
CADPVYKVYVAALKTLRAMLVYTPCHSLAERIKLQRLLRPVVDTILVKCADANSRTSQLS
ISTLLELCKGQAGELAVGREILKAGSIGIGGVDYVLNCILGNQIESNNWQELLGRLCLVD
RLLLEFPAEFYPHIVSTDVSQAEPVEIRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLS
SARMVTAVPHVFSKLLEMLTVSSSTHFTRMRRRLLAIADEVEIAEAIQLDMEDGLGRRQD
SFLQASVPNSYPETTENGSRECTAHTEKTGKGLCAAKLSASSEDISDRLASISLGLPCSA
TTEQPKPVIQTKGRPHSQCLNSSPLSHHSQLGFPALSTPSSSAPSGPAGTVTDVCKHRPQ
GFVPCKIPSASPQTQRKFSLQFQRNCCENKDSDKLSPIFTQSRPLPSSNIHRPKPSRPTP
GNTSKQGDASKNGMTLDLSTTSKCDDSIGSSSHGSNAVIPSDETVFTPVEEKGRLDVNTE
LNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQKCKEKMEAEEEE
ALAIAMAMSASQDALPIVPQLQVENGEDIIIIQQDTPETLPGHTKAKQPYREDTEWLKGQ
QIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNII
RMLGATCEKSNYNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIH
RDVKGANLLIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYG
RSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALR
CLELQPQDRPPSRELLKHPVFRTTW
NT seq 4038 nt   +upstreamnt  +downstreamnt
atggagaataaagaaactctcaaagggctacacaagatggatgatcgcccagaagagcgg
atgatcagggagaaactgaaggcaacatgcatgccggcctggaagcacgagtggctggaa
aggagaaataggagaggccctgtggtggtaaaaccaatccctattaaaggagatggatcc
gaaatgagtaacttggccgctgaatgtcaaggagagggccaggtgggcgctgcgtctcca
gcccccaaaggccggcgcagcccgtctcccagcagctccccttcaggtcgcatagtgaaa
tccgaatcgccaggagtaaggagaaaaagagtttctccggtgccttttcagagtggccgg
atcacaccaccccggagagcgccctcaccagatggcttctcaccatacagccccgaggaa
acaaaccgccgtgtgaacaaggtgatgcgggccaggctgtacttgctgcagcaaatagga
cccaactctttcctgattggaggggacagcccggacaataaataccgcgtgtttataggg
ccacagaactgcagctgtgggcgtggaacattttgtatccatctgttgtttgttatgctc
cgggtgtttcaactagaaccttcagacccaatgctgtggagaaaaaccttaaagaatttt
gaggttgagagtttgttccagaaatatcacagtaggcgtagctcaaggatcaaagctcca
tctcgtaacaccatccagaagtttgtttcacgcatgtcaaattctcatacattgtcatca
tctagtacttctacatctagttcagaaaacagcataaaagatgaagaggagcaaatgtgt
cctatctgcttgttgggcatgctggacgaggagagcctgacagtgtgtgaggatggctgc
aggaacaagctgcaccaccactgcatgtccatatgggcagaagaatgtagaagaaataga
gaacctttaatatgtcccctttgtagatctaagtggcggtcccatgatttttatagccac
gagttgtcgagccctgtggattccccctcttcccttcgaactgcacagcaacaaacccta
cagcagccacctttggctggatcacaaagaaggactcaagagagcaacttcaaccttact
cactatggaactcagcagatcccacctgcttacaaagatctggctgagccatggattcag
gtgtttggaatggaactcgttggctgcttattttctagaaactggaatgtcagagagatg
gccctcaggcgtctttcccatgatgttagtggggccctgctgttggcaaatggggagagc
actggaaattccgggggcagcggtggcagcagtccgagcgtgggagccgccagtgggtct
ccacaggccagcgtctctggggacgtggtggaggcgtgctgcaacgtcttgtcggtggtc
tgcgccgaccctgtctacaaagtgtacgttgctgctttaaaaacattgcgagctatgctg
gtgtacactccttgccacagtctggcagaaagaatcaagctccagagactcctccgacca
gttgttgacaccatcctcgtcaagtgtgctgatgccaacagccgcacaagtcagttgtcc
atatcaacactgttggaattgtgcaaaggccaagcaggagagttggcagttggtagagaa
atacttaaagctggatccattggaattggtggtgttgattatgtcttaaattgtattctt
ggaaaccaaattgaatcaaacaactggcaagaactcctgggccgcctttgtcttgtagat
agactgttgttggagtttcctgctgaattttatcctcatattgtcagtactgacgtctca
caagctgagcctgttgaaatcaggtataagaagctgctgtccctcttaacctttgctttg
cagtccattgataattcccactcaatggtgggtaaactctcccgaaggatctacttgagt
tctgcgaggatggtgaccgcagtgccccacgtgttttcaaagctgttggagatgctgacc
gtctccagctctactcacttcaccaggatgcgccgccggctgctggctattgcggatgag
gtggaaattgctgaggccatccagctagacatggaagacggcctgggacgccgccaggac
agctttctgcaggcatctgtccctaacagctatcccgaaaccacagagaacggctcccgt
gagtgcacagcccatacagagaaaactggaaaaggattgtgtgctgcaaaattgagtgcc
agctcagaggacatttctgacagactggccagcatttcactgggacttccttgttcagca
acaacagagcagccaaagccagtgattcagacaaaaggcagaccccacagtcagtgtttg
aactcttctcctttatctcatcattcgcaattagggttcccagccttatcaaccccttcc
tcctcggccccatctggaccagccggcactgtaacagatgtctgtaagcatagacctcag
ggattcgttccctgcaaaataccctctgcatctcctcagacacaacgcaagttttctcta
caattccagagaaactgttgtgaaaacaaagactcagataaactctccccaatctttact
caatcgagacccctgccctccagtaacatacacaggccaaagccatctcgacctacgcca
ggtaatacaagtaaacagggagatgcctcaaaaaatggcatgacacttgatctgagcact
acttccaaatgtgacgacagcattggcagtagcagccatggtagtaatgctgttataccc
agtgatgagacagtgttcaccccagtcgaggagaaaggcagattagatgtcaatacagag
ctcaactccagtatcgaggaccttcttgaagcttccatgccttctagtgacacaacagta
accttcaagtcagaagttgctgtcctgtctcctgaaaaggctgagaatgatgacacctac
aaagatgatgtaaatcataatcagaagtgcaaagagaagatggaagctgaggaagaagaa
gctttagccattgccatggcaatgtcagcatcgcaggatgccctccccatagttcctcaa
ctgcaggttgaaaacggagaagatatcatcattatccaacaggatacaccagaaactcta
ccaggacataccaaagcaaaacagccttacagagaagacaccgagtggctgaaggggcag
cagataggccttggagcgttttcttcttgttatcaggctcaagatgtgggaactggaact
ttaatggctgttaaacaggtgacatatgtcagaaacacgtcctctgagcaggaggaagtg
gtggaagccctgcgagaagagatcagaatgatgagccatctgaatcacccgaacatcatc
aggatgttgggagccacgtgtgagaagagcaactataatctcttcattgagtggatggca
gggggatctgtggcccatttgctgagtaaatacggagcctttaaggaatcagtcgttatt
aattatactgagcagctgcttcgtggcctgtcctacctccatgagaaccagatcattcac
agagatgtcaaaggtgccaatttgctgattgacagcacaggtcagagactgagaattgca
gattttggagctgcagccaggttggcatcgaaaggcactggtgcaggagagtttcaggga
cagttactggggacgatcgcattcatggcacctgaggtactaagaggtcagcagtatggt
aggagctgtgacgtctggagtgttggctgtgctattatagaaatggcttgcgcaaaacca
ccttggaatgcagaaaaacactccaatcatcttgctttaatatttaagatcgctagtgca
actactgctccatccatcccgtcacatctgtcacccgggttacgggacgtggccctgcgc
tgcttagaactgcaacctcaggacaggcctccctcaagagagctactgaagcaccccgtc
ttccgtaccacgtggtag

DBGET integrated database retrieval system