Oryctolagus cuniculus (rabbit): 100348492 Help Entry 100348492         CDS       T03373                                  Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04072   Phospholipase D signaling pathway ocu04140   Autophagy - animal ocu04150   mTOR signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04152   AMPK signaling pathway ocu04211   Longevity regulating pathway ocu04218   Cellular senescence ocu04714   Thermogenesis ocu04910   Insulin signaling pathway ocu04919   Thyroid hormone signaling pathway ocu05163   Human cytomegalovirus infection ocu05165   Human papillomavirus infection ocu05168   Herpes simplex virus 1 infection ocu05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     100348492    04151 PI3K-Akt signaling pathway     100348492    04152 AMPK signaling pathway     100348492    04150 mTOR signaling pathway     100348492  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100348492  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     100348492   09149 Aging    04211 Longevity regulating pathway     100348492   09159 Environmental adaptation    04714 Thermogenesis     100348492  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     100348492   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100348492    05165 Human papillomavirus infection     100348492  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:ocu04031]     100348492 GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Ras Family    Rheb     100348492 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  100348492 NCBI-ProteinID:  XP_002715109 Ensembl:  ENSOCUG00000013173 UniProt:  G1T4W2 LinkDB All DBs Position 13:complement(13182038..13252625) Genome browser AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcattgacgattcagtttgttgaaggtcaatttgttgactcctacgatccaaccatagaa aacactttcacaaagttgatcacagtaaatggacaagaatatcatcttcaacttgtagac acagctgggcaagatgaatattccatctttcctcagacatactccatagatattaatggt tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttatccat ggcaaattgttggacatggtggggaaagtgcaaatacctattatgctggttgggaataag aaagacctgcatatggaaagggtgatcagttatgaagaagggaaagctttggcagaatct tggaacgcagcttttttggagtcttctgctaaagaaaatcagactgctgttgatgttttc agaaggataattttggaggcagaaaaaattgatggggcggcttcacaaggaaagtcttcg tgctcggtgatgtga

DBGET integrated database retrieval system