KEGG   Oryctolagus cuniculus (rabbit): 100348597
Entry
100348597         CDS       T03373                                 
Symbol
DDX3X
Name
(RefSeq) DEAD-box helicase 3, X-linked
  KO
K11594  ATP-dependent RNA helicase DDX3X [EC:3.6.4.13]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu05161  Hepatitis B
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100348597 (DDX3X)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100348597 (DDX3X)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100348597 (DDX3X)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100348597 (DDX3X)
   03041 Spliceosome [BR:ocu03041]
    100348597 (DDX3X)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100348597 (DDX3X)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100348597 (DDX3X)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100348597 (DDX3X)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100348597 (DDX3X)
Spliceosome [BR:ocu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    100348597 (DDX3X)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    100348597 (DDX3X)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII UTP25
Other DBs
NCBI-GeneID: 100348597
NCBI-ProteinID: XP_002719895
Ensembl: ENSOCUG00000012338
LinkDB
Position
X:26686645..26701717
AA seq 661 aa
MSHVAVENALGLDQQFAGLDLNSSDNQTGGSTASKGRYIPPHLRNREATKGFYDKDSSGW
SSSKDKDAYSSFGSRGDSRGKSSFFSDRGSGSRGRFDDRGRGDYDGIGSRGDRSGFGKFE
RGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIE
SFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILS
QIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVV
YGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQ
IRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVV
WVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDR
EEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGL
ATSFFNERNVNITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSRFSGGFGARD
YRQSSGASSSSFSSSRASSSRSGGGGHGGSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWG
N
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgagtcatgtggcggtggaaaatgcgctcgggctggaccagcagtttgctggcctagac
ctgaactcttcagataatcagactggaggaagtacagccagcaaagggcgctatattcct
cctcatttaaggaacagagaagctactaaagggttctacgacaaagacagttcagggtgg
agttctagtaaagataaggatgcatacagcagttttggatctcgcggtgactcaagaggg
aagtccagtttcttcagtgatcgaggaagtggatcaagaggaaggtttgatgatcgtgga
cgtggtgactatgatggcattggcagccgtggcgacagaagtggctttggcaaatttgaa
cgtggtggaaacagtcgctggtgtgacaaatcagatgaagatgattggtcaaaaccactc
ccaccaagtgaacgcttggaacaggaactcttttctggaggcaacactgggattaacttc
gagaaatacgatgacattccagttgaggcgacaggtaacaactgccctccacatattgag
agtttcagtgatgttgaaatgggagaaattattatgggaaacattgagcttactcgttat
actcgcccaactccagtgcaaaagcatgctattcctattatcaaagagaaaagagacttg
atggcttgtgcccaaacaggatctggaaaaactgcagcatttctcctgcctattttgagt
cagatttattcagatggtccaggcgaggctttgagggccatgaaggaaaatggaaggtat
gggcgtcgcaaacaatacccaatctccttggtattggcgccaacacgagaattggcggta
cagatctatgaggaagccagaaaattttcctaccgatctagagtccgtccttgtgtggtg
tatggtggtgctgatattggtcagcagattcgagacctagaacgtggatgccacttgcta
gtagccactccaggacgtttagtggatatgatggaaagaggaaaaattggattagacttc
tgcaaatatctggtgttagatgaagctgatcggatgttggatatgggttttgaacctcag
atccgcagaatagttgaacaggatactatgcctccaaaaggtgtccgccacactatgatg
tttagtgctactttccctaaggaaatacagatgcttgctcgtgatttcttggatgaatac
atctttctggccgtgggaagagttggctctacttctgagaacatcacacagaaagtagtt
tgggtggaagaatcagacaaacggtcatttctgctcgacctcctaaatgctacaggcaag
gattcactgaccttagtgtttgtggagaccaaaaagggtgcagattctctggaggatttc
ttgtaccacgaaggatatgcttgtaccagtatccatggagaccgttctcagagagataga
gaagaggcccttcaccagttccgctcaggaaaaagcccaattctagtggctacagcagta
gcggcaagaggactggacatttcaaatgtgaaacatgtcatcaactttgacttgccaagt
gatattgaagaatacgtgcatcgcattggccgtacaggacgtgtaggaaaccttggcctt
gccacctcattctttaatgagagaaacgtgaatatcactaaggatttgttggatcttctt
gttgaagctaaacaagaagtgccatcttggttagaaaacatggcttatgaacaccactac
aagggcagcagtcgtggacgttctaagagtagatttagtggaggatttggtgccagagac
taccgacaaagcagtggtgccagcagttcaagcttcagtagcagccgagcgagcagcagc
cgaagtggtggaggtggccatggtggcagcagaggctttggtggaggtggctatggaggc
ttttacaacagtgatggatatggaggaaattataactcccagggggttgactggtggggt
aactga

DBGET integrated database retrieval system