KEGG   Oryctolagus cuniculus (rabbit): 100348730
Entry
100348730         CDS       T03373                                 
Symbol
IL26
Name
(RefSeq) interleukin 26
  KO
K05446  interleukin 26
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348730 (IL26)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348730 (IL26)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100348730 (IL26)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 100348730
NCBI-ProteinID: XP_002711293
Ensembl: ENSOCUG00000000495
UniProt: G1SDF0
LinkDB
Position
4:complement(47203587..47216977)
AA seq 180 aa
MWVKCTVGSGWLLVTLSLAIASHKPSFITKNCYSWDSLSQAIDTLYVKAAQLKETVPEDS
IKNVRLLKKNTKELFLTNCRFQEQLLSFFMDDVFGQLQFQAFNETDFVEDFHCFRQKLSR
CITCASSAREMKSITRMKRTFYGIGNKGIYKAIGELDILLSWIKKFLESIPEIKKPSIEI
NT seq 543 nt   +upstreamnt  +downstreamnt
atgtgggtgaaatgcactgtggggtctggatggctgctggtcactctgtctcttgccatt
gcttcacacaagccatctttcatcaccaaaaactgctactcctgggattctctgtcccaa
gccatcgacactctgtatgtcaaggcagcacagctcaaagagacagtcccagaagacagc
attaaaaatgtacgattattaaaaaagaacacaaaagagctgtttttgacaaactgcaga
ttccaagaacagcttctgtccttcttcatggacgatgtttttggtcaactccaattccaa
gctttcaacgaaactgactttgtggaagactttcattgttttaggcagaaattgagccgt
tgtattacctgtgcttcctcagccagagagatgaaatccattaccaggatgaaaagaacg
ttttatgggattggaaacaaaggaatctacaaagcgattggtgaactggatattcttctg
tcctggattaaaaagttcttggaaagcattccggaaatcaagaagccaagcatagagatt
tga

DBGET integrated database retrieval system