KEGG   Oryctolagus cuniculus (rabbit): 100348776
Entry
100348776         CDS       T03373                                 

Symbol
CCL3
Name
(RefSeq) C-C motif chemokine 3-like 1
  KO
K05408  C-C motif chemokine 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04620  Toll-like receptor signaling pathway
ocu05142  Chagas disease
ocu05163  Human cytomegalovirus infection
ocu05323  Rheumatoid arthritis
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348776 (CCL3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100348776 (CCL3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100348776 (CCL3)
   04062 Chemokine signaling pathway
    100348776 (CCL3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100348776 (CCL3)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100348776 (CCL3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100348776 (CCL3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100348776 (CCL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348776 (CCL3)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100348776 (CCL3)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100348776 (CCL3)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Chemokines
   100348776 (CCL3)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100348776
NCBI-ProteinID: XP_002719292
Ensembl: ENSOCUG00000000771
UniProt: G1SE13
LinkDB
Position
19
AA seq 93 aa
MKVSGVALAVLLCAMALSTQVFSIPLGADTPTACCFSYISRQIPYKFIADYFETSSQCSK
PGVIFLTKRGRQVCADISEAWVQGYINDLELNS
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaaggtctccggggttgccctcgccgtcctcctgtgcgccatggctctcagcacccag
gtcttctccataccacttggtgccgacaccccgaccgcctgctgcttctcctacatctcc
cgccagatcccctacaaattcatagccgactattttgagaccagcagccagtgctccaag
ccaggcgtcattttcctaaccaagagaggccggcaggtgtgcgctgacatcagtgaggcc
tgggtccagggctacatcaatgacctggaactgaattcctaa

DBGET integrated database retrieval system