Oryctolagus cuniculus (rabbit): 100348776 Help Entry 100348776         CDS       T03373                                  Name (RefSeq) C-C motif chemokine 3-like 1   KO K05408   C-C motif chemokine 3 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04061   Viral protein interaction with cytokine and cytokine receptor ocu04062   Chemokine signaling pathway ocu04620   Toll-like receptor signaling pathway ocu05142   Chagas disease ocu05163   Human cytomegalovirus infection ocu05323   Rheumatoid arthritis ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100348776    04061 Viral protein interaction with cytokine and cytokine receptor     100348776  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100348776    04062 Chemokine signaling pathway     100348776  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100348776   09174 Infectious disease: parasitic    05142 Chagas disease     100348776   09163 Immune disease    05323 Rheumatoid arthritis     100348776   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100348776  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100348776    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     100348776 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Chemokines    100348776 Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Chemokines    100348776 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100348776 NCBI-ProteinID:  XP_002719292 Ensembl:  ENSOCUG00000000771 UniProt:  G1SE13 LinkDB All DBs Position 19:complement(22606310..22608009) Genome browser AA seq 93 aa AA seqDB search MKVSGVALAVLLCAMALSTQVFSIPLGADTPTACCFSYISRQIPYKFIADYFETSSQCSK PGVIFLTKRGRQVCADISEAWVQGYINDLELNS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccggggttgccctcgccgtcctcctgtgcgccatggctctcagcacccag gtcttctccataccacttggtgccgacaccccgaccgcctgctgcttctcctacatctcc cgccagatcccctacaaattcatagccgactattttgagaccagcagccagtgctccaag ccaggcgtcattttcctaaccaagagaggccggcaggtgtgcgctgacatcagtgaggcc tgggtccagggctacatcaatgacctggaactgaattcctaa

DBGET integrated database retrieval system