KEGG   Oryctolagus cuniculus (rabbit): 100348847
Entry
100348847         CDS       T03373                                 
Symbol
HERC4
Name
(RefSeq) HECT and RLD domain containing E3 ubiquitin protein ligase 4
  KO
K10615  E3 ubiquitin-protein ligase HERC4 [EC:2.3.2.26]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100348847 (HERC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100348847 (HERC4)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     100348847 (HERC4)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   100348847 (HERC4)
SSDB
Motif
Pfam: RCC1 HECT RCC1_2 LAIKA
Other DBs
NCBI-GeneID: 100348847
NCBI-ProteinID: XP_002718504
Ensembl: ENSOCUG00000009927
UniProt: A0A5F9DLL4
LinkDB
Position
18:18535447..18685839
AA seq 1057 aa
MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKKVRDVGCGLRHTVFVLDDGTVYTCGC
NDLGQLGHEKSRKKPEQVVALDAQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGLLG
SEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGIDCKKQTS
PQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDENDRYVPNLLKSLR
SQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHEINPRKVFELMGSIVTQIA
CGRQHTSAFVPSSGRIYSFGLGGNGQLGTGSTSNRKSPFTVKGNWLPYNGQCPPDIDSEE
YFCVKRIFSGGDQSFSHYCSPQNCGPPDDFRCPDPSKQIWTVNEALIQKWLSYPSGRFPV
EIANEIDGTFSSSGCLNGSFLAVSNDDHYRTGVRFSGVDMNAARLLFHKLIQPDHPQISQ
QVAASLEKNLIPKLTSSLPDVEALRFYLTLPECPLMSDSNNFTTIAIPFGTALVNLEKAP
LKVLENWWSVLEPPLFLKIVELFKEVVVHLLKLYKIGIPPSERRIFNSFLHTALKVLEIL
HRVNEKTGQIIQYDKFYIHEVQELIDIRNDYINWVQQQAYGMDVNHGLTELADIPVTICT
YPFVFDAQAKTTLLQTDAVLQMQMAIDQAHRQNVSSLFLPVIESVNPCLILVVRRENIVG
DAMEVLRKTKNIDYKKPLKVIFVGEDAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSR
LIWFSDKTFEDSDLFHLIGVICGLAIYNFTIVDLHFPLALYKKLLKKKPSLDDLKELMPD
VGRSMQQLLDYPEDDIEETFCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAY
VDYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQPNELQAMVIGNTNYDWKELEKNTEYKG
EYWAEHPTIKIFWEVFHELPLEKKKQFLLFLTGSDRIPILGMKSLKLVIQSTGGGEEYLP
VSHTCFNLLDLPKYTEKETLRSKLIQAIDHNEGFSLI
NT seq 3174 nt   +upstreamnt  +downstreamnt
atgttgtgctggggaaatgcatccttcggacagctaggtttgggtggaattgatgaagaa
attgtattagagcccagaaaaagtgacttttttataaataaaaaggtccgagatgtagga
tgtggactcagacacaccgtatttgttttggatgatgggacagtgtacacatgtggatgt
aatgatctgggacaactgggtcatgagaaatccagaaagaaaccagagcaggttgttgcc
ctggatgctcaaaatatcgtagctgtatcatgtggagaagctcatacattagcactaaat
gacaagggacaggtgtatgcttggggtctcgattctgatggacaacttggcctgctagga
tcagaggaatgtatcagagtaccaaggaacattaaaagtttgtcagatatccagatcgta
caagttgcttgcggttattatcattcacttgcactttctaaagcaagtgaagtcttctgt
tggggacagaataaatatggccagttgggtttaggcattgactgtaaaaagcaaacttca
cctcagctgattaagtctttgcttggaatccctttcatgcaagttgctgcaggaggagcc
catagttttgtactcactctttctggagctatctttggatggggacgcaacaaatttggt
caactgggtcttaatgatgaaaatgatagatatgttcctaatttactaaagtcactaaga
tctcagaaaatagtttatatttgttgtggagaagaccatactgctgcactcaccaaggaa
ggaggagtatttacctttggagctggagggtatggtcagttgggtcataactctaccagt
catgagataaatccaaggaaagtttttgaacttatgggaagcattgtcactcagattgct
tgtggaaggcagcacacttctgcttttgttccttcatcaggacgaatttactcttttgga
cttggtggtaatgggcagctagggactggttcaacaagcaacaggaaaagtcctttcact
gtgaaaggaaattggctcccttataatggccagtgtccaccagatatagattctgaagaa
tatttctgtgtaaaaagaattttctcaggtggagatcaaagcttttcacattactgtagt
cctcagaactgtgggccaccagatgactttagatgtcctgatccttcaaaacagatatgg
acagtgaatgaagctctaattcaaaaatggctgagctatccctctggaaggtttcctgtg
gagatagccaatgaaatagatggaacattttcttcctctggttgcctaaatggaagtttt
ctagctgttagcaatgatgatcattatagaacaggtgtcagattttcaggggttgatatg
aatgctgctaggcttttattccacaaacttatacaacctgatcatcctcagatatctcag
caggtggcagctagtttggaaaagaatcttattcctaaactgactagttccttacctgat
gttgaagcattgaggttttatcttactctgccagaatgtcccctgatgagtgattccaac
aatttcacaacaatagcaattccctttggtacagctcttgtgaacctagaaaaggcacca
ctgaaagtacttgaaaactggtggtcagtacttgagcctccactattcctcaagatagta
gaactttttaaggaagttgtggtacatcttttgaaactctacaagatcggcattccccct
tctgaaagaagaattttcaacagctttcttcataccgcattaaaggttttagaaatatta
catagggtaaatgagaaaacggggcagattatacagtatgataaattttatatacatgaa
gtacaagaattaatagacataaggaatgattatatcaactgggttcaacagcaggcctat
ggaatggatgtcaaccatggattaactgagttggcagatatccctgtaacaatctgcaca
tatccatttgtatttgatgcccaagcaaaaactactctgttacagacagatgcagtctta
cagatgcagatggctattgaccaggcccacagacagaatgtctcctctctttttctccca
gttattgaatctgtgaatccctgcttaattctagtggtgcgtagagaaaacattgtagga
gatgcaatggaagttcttaggaaaacaaagaacatagattacaaaaagccgctcaaggtt
atatttgttggagaagatgctgttgatgcaggaggggtacgcaaagaatttttcttgctc
atcatgagggaattactggatcctaaatatggcatgtttaggtattatgaagattccagg
cttatttggttttctgataagacatttgaagacagtgatttgttccatttgattggtgtt
atttgtggattagcaatttataattttactattgtggacctccattttcctttggctttg
tataagaaactgctgaaaaagaagccatccctggatgatttgaaagaattaatgcctgat
gttgggagaagcatgcaacagttactggattacccagaagatgatatagaggaaacgttt
tgtctaaactttacgatcacagttgaaaactttggtgcaacagaagtgaaagagctggtt
ctaaatggtgcagacacagctgttaacaaacaaaatcggcaggagtttgttgatgcttat
gtggattacatattcaataaatcagtggcttccctatttgatgcttttcatgcgggcttt
cataaggtctgtggaggaaaagtccttctgctcttccagccaaatgaactacaagcaatg
gttattggaaatacaaattatgattggaaggaactggaaaagaatacagaatacaaaggg
gaatactgggcagaacatcctacaataaaaattttttgggaagtgtttcatgaattacca
ttggaaaagaaaaaacaatttctattatttttgacaggtagtgatcgcattcctattctt
ggtatgaagagtctcaaactagtcatccagtcaacaggaggtggtgaggaatatctccca
gtttctcatacctgttttaatcttctggatcttccgaaatatacagaaaaagaaactctg
cgttctaaactgatccaagctattgatcacaatgaaggcttcagtttaatataa

DBGET integrated database retrieval system