Oryctolagus cuniculus (rabbit): 100348869 Help Entry 100348869         CDS       T03373                                  Name (RefSeq) C-C motif chemokine 27   KO K16598   C-C motif chemokine 27 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04061   Viral protein interaction with cytokine and cytokine receptor ocu04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100348869    04061 Viral protein interaction with cytokine and cytokine receptor     100348869  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     100348869  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100348869 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Chemokines    100348869 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100348869 NCBI-ProteinID:  XP_002707984 Ensembl:  ENSOCUG00000001224 UniProt:  A0A5F9CTF0 LinkDB All DBs Position 1:33291036..33293159 Genome browser AA seq 121 aa AA seqDB search MEGCSPTSRLLLLLLLLSLDPGAVLILPPSTTCCTQLYRQPLSNKLLRKVIRVELQEADG DCHLQAFVLHLARRSVCIHPQNRSLARWFERQGKRLQGTQPDFWVARENGLEPHKAPIKQ H NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggaggggtgttcacctaccagcaggctcctgctgctgctgttgctcctgagcctggac cctggagcagtgttgatactgccacccagcactacctgctgtactcagctctaccgacag ccactgtcaaacaagctactgaggaaggtcatccgggtggaactgcaggaggctgatgga gactgtcacctgcaggctttcgtgcttcatctggctcgacgcagcgtgtgcattcatccc cagaaccgcagcctggctcggtggttcgagcgccaagggaagaggctccaggggactcaa cctgatttctgggttgctagggaaaatgggttggagccccacaaagccccaataaagcaa cattag

DBGET integrated database retrieval system