KEGG   Oryctolagus cuniculus (rabbit): 100348914
Entry
100348914         CDS       T03373                                 
Symbol
TNFRSF9
Name
(RefSeq) TNF receptor superfamily member 9
  KO
K05146  tumor necrosis factor receptor superfamily member 9
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348914 (TNFRSF9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100348914 (TNFRSF9)
   04090 CD molecules [BR:ocu04090]
    100348914 (TNFRSF9)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100348914 (TNFRSF9)
CD molecules [BR:ocu04090]
 Proteins
  100348914 (TNFRSF9)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 100348914
NCBI-ProteinID: XP_008264195
Ensembl: ENSOCUG00000002364
UniProt: G1SHD7
LinkDB
Position
13:141919501..141939432
AA seq 258 aa
MQDFIMGGSYYNMVAAVLLVMNVERARSVQGPCANCPAGTFCGKSRNPIFVPCPPNSLSC
GSGQRTCVLCRRCEGVFRTKKPCSPTSDTECECIAGFHCLGPGCSMCEQDCEQGQEFTKE
GCKDCPFGSFNNQKGGICQPWTNCSGGRPVLVNGTKDSDVVCGPTAPGFSPGASSTTSPP
PPPAGHSPQVIPFLLALTWAAVLFLVFFLVLHFSLAKRSRKKLLYIFKQPFMKPIQTAQE
EDACSCQFPEEEEGGYEP
NT seq 777 nt   +upstreamnt  +downstreamnt
atgcaagacttcatcatgggaggcagctactacaacatggtggcagccgtgctgctggtc
atgaacgtggagagagcgagatcggtgcagggaccctgtgctaactgcccagctggtact
ttctgtgggaaaagcaggaatccgatttttgttccctgtcctcccaatagcctctcctgt
ggcagtggacagcggacctgtgtgctgtgcaggcgctgtgaaggtgttttcaggaccaag
aagccgtgctccccgaccagtgacaccgagtgtgaatgcattgccgggttccactgcctg
gggccgggctgcagcatgtgtgaacaggattgtgagcaaggtcaagagttcacaaaggag
ggttgcaaagactgtccctttggctcctttaacaaccagaaaggtggcatctgtcaaccc
tggacaaactgttcaggtgggaggcctgtgcttgtgaatgggaccaaggacagcgatgtg
gtctgcggaccgaccgcgcccggcttctctccaggtgcctcctccaccacctcgcctccg
cctccgcctgcagggcacagtccacaggtcatccccttcctcctggcgctgacgtgggct
gcggtgctgttcctggtcttcttccttgtgctccatttctctctggccaagcggagcagg
aagaaactcctgtacatcttcaagcaaccgtttatgaaaccgatacaaactgcccaagag
gaagacgcctgcagctgccagtttccggaggaagaggagggtggatatgaaccgtga

DBGET integrated database retrieval system