KEGG   Oryctolagus cuniculus (rabbit): 100348954
Entry
100348954         CDS       T03373                                 
Symbol
IFNK
Name
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100348954 (IFNK)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348954 (IFNK)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100348954 (IFNK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348954 (IFNK)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100348954 (IFNK)
SSDB
Motif
Pfam: Interferon DIT1_PvcA DUF3958
Other DBs
NCBI-GeneID: 100348954
NCBI-ProteinID: XP_002708089
LinkDB
Position
1:complement(26020642..26052495)
AA seq 253 aa
MYVSLDHGRKHLSKFDLFTGHDSSDEFKARPPLALVANEDTVHLDHAISTSNPLHPDMIQ
KCWWLAFLMHVFIIGFQALDCDFLNVNLNRVIRKNMKLLRNVSHSFPIECLREIKDFELP
QEILSHSQMEKRDIKEAWYEISTQAFCIFMGHAFQTTWEETHLTQIQNGLYEQVAYLEQC
LMEDIHETKEEEMKYSGTGRFLLNNLELRKYFYRMNNFLEDKKYSYCAREIVRVEITRCF
SYFYRFTAFLRRR
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtacgtttcattagaccatggcaggaagcatttgtccaagtttgacctatttacaggg
catgattcttctgatgagttcaaggcccgtcctcctctggctcttgttgcaaatgaagac
accgtgcacttagaccatgcaatatcaacttctaaccctctccaccctgacatgattcaa
aagtgttggtggcttgcattccttatgcatgtgttcattatcggtttccaagctctggac
tgtgacttcttgaatgttaacctcaatagggtcatccggaaaaacatgaaacttctgaga
aatgtgagccattcatttcccatagagtgtctaagagaaatcaaagattttgagttaccc
caagagatcctatcacacagccagatggagaaaagggacatcaaggaagcctggtatgaa
atatccacacaggccttctgtatcttcatgggacatgccttccagaccacttgggaagag
acacatctgacgcaaattcaaaatggactttatgagcaagtggcatatctggaacaatgc
ctaatggaagacatacatgaaaccaaagaggaggagatgaaatactcaggcactgggcgc
ttcctgctcaacaacctggagctgaggaagtatttctacaggatgaacaatttcctggaa
gataagaaatacagttactgtgccagggagatcgtccgagtggaaatcacaagatgtttc
tcctacttttacagattcacagcatttctcaggaggagataa

DBGET integrated database retrieval system