KEGG   Oryctolagus cuniculus (rabbit): 100348980
Entry
100348980         CDS       T03373                                 
Symbol
IL22
Name
(RefSeq) interleukin 22
  KO
K05445  interleukin 22
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04659  Th17 cell differentiation
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100348980 (IL22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348980 (IL22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100348980 (IL22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100348980 (IL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348980 (IL22)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100348980 (IL22)
SSDB
Motif
Pfam: IL22 IL10 Cobalamin_bind Laminin_B IL28A RNA_pol_Rpb2_7
Other DBs
NCBI-GeneID: 100348980
NCBI-ProteinID: XP_002711294
Ensembl: ENSOCUG00000001663
UniProt: G1SFV3
LinkDB
Position
4:complement(47237617..47243365)
AA seq 187 aa
MAALQKSVISFLMGTLGASGLLLMALMAHGGAALPISSHCRLDESNFTSYITNLTFMLAK
EANSADNNTDVRLIGNELFHGVNEKDHCYLLKHVLNFTLEEVLFPESDRFQPYMQQVLSF
LAKLSNNLSQCHIEGDDQHIQRNVQQLKDTVKQLGESGEIKAIGELDLLFMALRTACVSP
EQSWKMS
NT seq 564 nt   +upstreamnt  +downstreamnt
atggctgccctgcagaagtctgtgatctcgttcctgatggggactctgggagccagcggc
ctcctgctcatggccctgatggcacacggaggagctgcgctgcccatcagctcccactgc
aggctggacgagtccaacttcacttcctatatcaccaacctcaccttcatgctggctaag
gaggccaattcggcagataacaacacagatgttcgtcttattgggaatgagctgttccat
ggagtcaatgagaaagaccactgctatctgctgaagcacgtgctcaactttacccttgaa
gaagtgctgttccccgagtctgatagattccagccctacatgcagcaggtgctgtccttc
ctggccaagcttagcaacaatctcagccaatgtcatattgaaggcgatgaccagcatatc
cagcggaatgtgcagcagctgaaggacacagtgaagcagcttggagagagtggagagatc
aaagcaattggagaactggatctgctgtttatggccctgagaactgcctgcgtttcaccg
gagcaaagctggaaaatgagttaa

DBGET integrated database retrieval system