KEGG   Oryctolagus cuniculus (rabbit): 100349095
Entry
100349095         CDS       T03373                                 
Symbol
NGFR
Name
(RefSeq) nerve growth factor receptor
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04215  Apoptosis - multiple species
ocu04722  Neurotrophin signaling pathway
ocu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100349095 (NGFR)
   04014 Ras signaling pathway
    100349095 (NGFR)
   04015 Rap1 signaling pathway
    100349095 (NGFR)
   04151 PI3K-Akt signaling pathway
    100349095 (NGFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100349095 (NGFR)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    100349095 (NGFR)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100349095 (NGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100349095 (NGFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100349095 (NGFR)
   04090 CD molecules [BR:ocu04090]
    100349095 (NGFR)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100349095 (NGFR)
CD molecules [BR:ocu04090]
 Proteins
  100349095 (NGFR)
SSDB
Motif
Pfam: TNFR_16_TM TNFR_c6 Death TPR_21
Other DBs
NCBI-GeneID: 100349095
NCBI-ProteinID: XP_008269543
Ensembl: ENSOCUG00000007635
LinkDB
Position
19:complement(38083773..38101586)
AA seq 422 aa
MDGPRLLLLPLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPC
LDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDTVCRCAYGYYQDETTGRCEAYRV
CEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLRECSRWADAE
CEAIPGRWTTRSPAPEGSDSMAPSTQVPEGPPEQELPASTAADVVTTVMGSSQPVATRGT
ADSLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGADSRPVNQTPPPEGEKLHSDSGI
SVDSQSLHDQQPHTQTASGQGERGTGGLYSSLAPSKREERWRKLLNGFRGGHPAATLAAE
LGSQPEHIDSFPTRPSPARALLASWAAQDSATLDALLAALRRIQRADIVESLCSESTATS
PV
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggacgggccgcgcctgctgctgctgccgctgctgctactgggggtgtccctcggaggt
gccaaggaagcatgccccacgggtctgtacacccacagtggcgagtgctgcaaagcctgc
aacctgggcgagggcgtggcccagccctgcggagccaatcagaccgtgtgtgagccctgc
ctggacagcgtgacgttctctgacgtggtgagtgccaccgagccgtgcaagccttgcacc
gagtgcgtgggcctgcagagcatgtcggcgccctgcgtggaggcggacgacaccgtgtgc
cgctgtgcctacggctactaccaggacgagacgactggacgctgcgaggcgtaccgcgtg
tgtgaggcgggctcgggcctggtgttctcgtgccaggacaagcagaacacggtgtgtgag
gagtgccccgacggcacctactctgacgaggccaaccacgtggacccgtgcctgccgtgc
accgtgtgcgaggacaccgagcgccagctgcgcgagtgctcgcgctgggccgatgctgag
tgcgaggccatccctggccgttggacgacacgatccccagccccagagggctcggacagc
atggcccccagcacgcaggtgcccgagggacctccagaacaagagctgccggccagcacg
gcggcagacgtggtgaccacagtgatgggcagctcccagcccgtggcgacccggggcacc
gctgacagcctcatcccagtctactgctccattctggcggctgtggttgtgggccttgtg
gcctacatcgccttcaagaggtggaacagctgtaagcagaacaagcaaggagccgacagc
cgcccggtgaaccagacgcccccgcccgagggagaaaaactccatagtgacagcggcatc
tctgtggacagccagagcctgcatgaccagcagccccacacacagacggcctcgggccag
ggtgagcgggggaccgggggcctttacagcagccttgccccttccaagcgggaagagagg
tggaggaagctgctaaacggcttccgggggggacacccggcggccaccctggcggcggag
ctgggctcccagccggaacacatagattcctttcccacgaggccttcccccgcccgcgcc
ctgctggccagctgggccgcccaggacagcgccacgctcgacgccctcttggccgcactg
cgccgcatccagcgagctgacatcgtcgagagcctgtgcagcgagtccacggccacgtcc
ccggtgtga

DBGET integrated database retrieval system