KEGG   Oryctolagus cuniculus (rabbit): 100349135
Entry
100349135         CDS       T03373                                 
Symbol
TMEM173
Name
(RefSeq) transmembrane protein 173
  KO
K12654  transmembrane protein 173
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu05163  Human cytomegalovirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100349135 (TMEM173)
   04622 RIG-I-like receptor signaling pathway
    100349135 (TMEM173)
   04623 Cytosolic DNA-sensing pathway
    100349135 (TMEM173)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100349135 (TMEM173)
   05171 Coronavirus disease - COVID-19
    100349135 (TMEM173)
   05168 Herpes simplex virus 1 infection
    100349135 (TMEM173)
   05163 Human cytomegalovirus infection
    100349135 (TMEM173)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100349135 (TMEM173)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    100349135 (TMEM173)
SSDB
Motif
Pfam: TMEM173 Yip1
Other DBs
NCBI-GeneID: 100349135
NCBI-ProteinID: XP_002710295
Ensembl: ENSOCUG00000006958
LinkDB
Position
3:complement(21716807..21722927)
AA seq 380 aa
MPQSSLHPAIPRPRGHGAEKAALVLLGVCLVSLWGLGEPPEHTLRCLVLHLASLQLGLLL
KGACCLAEELCHIHSRYQSSYWKAMRSCLGCPIRHGALMLLSCYFYSSLPNVAGLPLSWM
LALLGLSQALNILLGLQSLTPAEVSTICERKNFNVAHGLAWSYYIGYLRLILPGLHARIH
AYNQLHNNILSGMGSRRLYVLFPLDCGVPDDLSMADPNIRFLHMLPQQNTDRAGIKGRAY
SNSVYEILENGQPAAACVLEYATPLQTLFAMSQDGRAGFSREDRLEQAKLFCRTLEDILA
EAPEFQNNCCLIVYQEPAEGSSFSLSQEVLRHLRQQEREEVMVGHVGPLAVHGSPCTLSQ
EPQLLISGMEQPLPLRTDVF
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgccccagtcaagcctgcatccagccatcccacgacccaggggtcatggggccgagaag
gcagccttggttctgctgggtgtctgtctggtgtccctttgggggctgggggagccccca
gagcacactctgcggtgcctggtgctccacctggcctccctacagctgggactgctgttg
aaaggggcctgctgtctggcggaggagctgtgccacatccactccaggtaccagagcagc
tattggaaggccatgcggtcctgcctgggctgccccatccgccacggggccctgatgctg
ctgtcctgctatttctactcctccctcccgaatgtggcaggcctgcccctctcatggatg
cttgccctcctgggcctctcccaggcactgaacatcctcctgggcctacagagcctgacc
cccgctgaggtctctacaatctgtgaaagaaagaacttcaatgtggcccacgggctggca
tggtcgtactacattgggtacctgcggctgatcctgccagggctccacgctcggatccac
gcttacaatcaactccacaacaacatactatcgggcatgggcagccggcgcctgtacgtc
ctcttcccattggactgtggggtgcctgatgacctgagcatggccgaccccaacattcgt
ttcctgcatatgctgccccagcagaacactgaccgtgctggcatcaagggtcgggcttac
agcaacagtgtctatgagattctagagaatgggcagccggcagctgcctgtgtcctggag
tatgccacccctctgcagaccttgtttgccatgtcacaggatggccgggctggctttagc
cgtgaggatcggctggagcaggccaaactcttctgccggacactcgaggacatcctggca
gaggccccggagtttcagaacaactgctgcctcattgtctaccaggaacctgccgaggga
agcagtttctccctgtcacaggaggttctccggcacctgcggcagcaggaaagggaggag
gtcatggtgggccatgtggggcccctggcagtccatggttccccctgcacgctgtcccaa
gagccccagctcctcatcagtggcatggagcagcctctcccactgcgcactgatgtcttc
tga

DBGET integrated database retrieval system