KEGG   Oryctolagus cuniculus (rabbit): 100349255
Entry
100349255         CDS       T03373                                 
Name
(RefSeq) lymphotactin
  KO
K05507  C motif chemokine 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100349255
   04061 Viral protein interaction with cytokine and cytokine receptor
    100349255
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100349255
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100349255
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100349255
SSDB
Motif
Pfam: IL8 DUF6612
Other DBs
NCBI-GeneID: 100349255
NCBI-ProteinID: XP_002715264
Ensembl: ENSOCUG00000012952
UniProt: G1T4F1
LinkDB
Position
13:complement(24452558..24456199)
AA seq 114 aa
MRRLLLVLLCICCLTTSIVEGVGSEVPDKSICVSLTTQPLPVNRIRTYTIKEGPMKAVIF
ITKRGLKVCADPQAKWVKTAIKSISNKPSTRRSTTQTQPTGTQQSTRRAVTLTA
NT seq 345 nt   +upstreamnt  +downstreamnt
atgagacgtctgctcctggtcctcctctgcatctgctgtctcaccacatccattgtggaa
ggtgtggggagtgaagttccagataagagtatctgtgtcagtctgactacccagccactg
ccagtgaacaggatcaggacctacaccatcaaggagggccccatgaaagcagtaattttt
attaccaaacgtggcctaaaagtctgtgctgatccacaagccaagtgggtgaaaacagca
atcaaaagtataagtaacaagcccagcaccagaaggagcaccacccagacccagcctaca
ggaacccaacagtccaccaggagagctgtgaccctgactgcatag

DBGET integrated database retrieval system